From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002168000
  • symbol?:
  • description?: lipid phosphate phosphohydrolase 2 family protein

      descriptions from strain specific annotations:

    • lipid phosphate phosphohydrolase 2 family protein
    • membrane-associated lipid phosphatase PAP2
    • PAP2 family phosphatase/haloperoxidase
    • PAP2 superfamily protein
    • phosphatidylglycerophosphatase B-like protein
    • PAP2 superfamily phosphatase
  • strand?: +
  • coordinates?: 2673574..2675162
  • synteny block?: BlockID0014690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0432
    08BA02176:
    C248_0506
    11819-97:
    MS7_0429
    71193:
    ST398NM01_0522
    ECT-R 2:
    ECTR2_390
    ED133:
    SAOV_0473
    ED98:
    SAAV_0399
    HO 5096 0412:
    SAEMRSA15_03810
    JH1:
    SaurJH1_0491
    JH9:
    SaurJH9_0478
    JKD6008:
    SAA6008_00459
    JKD6159:
    SAA6159_00406
    LGA251:
    SARLGA251_03900
    M013:
    M013TW_0420
    MRSA252:
    SAR0456
    MSHR1132:
    SAMSHR1132_04010
    MSSA476:
    SAS0414
    Mu3:
    SAHV_0454
    Mu50:
    SAV0456
    MW2:
    MW0410
    RF122:
    SAB0406
    ST398:
    SAPIG0522
    T0131:
    SAT0131_00494
    TCH60:
    HMPREF0772_10066
    TW20:
    SATW20_05250
    USA300_TCH1516:
    USA300HOU_0461
    VC40:
    SAVC_01865

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIDKKLTSPKMTVPLFLIALIVFIGMFYSVVTNQEWLKNIDMGSLTWFTDYFGEPQRQYV
    N315            MIDKKLTSPKMTVPLFLIALIVFIGMFYGVVTNQEWLKNIDMGSLTWFTDYFGEPQRQYV
    NCTC8325        MIDKKLTSPKMTVPLFLIALIVFIGMFYSVVTNQEWLKNIDMGSLTWFTDYFGEPQRQYV
    Newman          MIDKKLTSPKMTVPLFLIALIVFIGMFYSVVTNQEWLKNIDMGSLTWFTDYFGEPQRQYV
    USA300_FPR3757  MIDKKLTSPKMTVPLFLIALIVFIGMFYSVVTNQEWLKNIDMGSLTWFTDYFGEPQRQYV
                    ****************************.*******************************

    COL             NNLFNYYMTFSAEIGDVKGVVLISIIVTIILFIKQRHLAVWFVTYLVSGVIMNKLIKDTV
    N315            NNLFNYYMTFSAEIGDVKGVVLISIIVTIILFIKQRHLAVWFVTYLVSGVIMNKLIKDTV
    NCTC8325        NNLFNYYMTFSAEIGDVKGVVLISIIVTIILFIKQRHLAVWFVTYLVSGVIMNKLIKDTV
    Newman          NNLFNYYMTFSAEIGDVKGVVLISIIVTIILFIKQRHLAVWFVTYLVSGVIMNKLIKDTV
    USA300_FPR3757  NNLFNYYMTFSAEIGDVKGVVLISIIVTIILFIKQRHLAVWFVTYLVSGVIMNKLIKDTV
                    ************************************************************

    COL             LRPRPYNHLAVDTGFSFPSGHSNASTLLYFALMIIIISLAAKTITKVLSALVMGILWLSI
    N315            LRPRPYNHLAVDTGFSFPSGHSNASTLLYFALMIIIISVAAKTITKVLSALVMGILWLSI
    NCTC8325        LRPRPYNHLAVDTGFSFPSGHSNASTLLYFALMIIIISLAAKTITKVLSALVMGILWLSI
    Newman          LRPRPYNHLAVDTGFSFPSGHSNASTLLYFALMIIIISLAAKTITKVLSALVMGILWLSI
    USA300_FPR3757  LRPRPYNHLAVDTGFSFPSGHSNASTLLYFALMIIIISLAAKTITKVLSALVMGILWLSI
                    **************************************:*********************

    COL             LFCRLYFHAHYFSDVIGGTSLAIIWVALFLMVYPYFINHRRQRV
    N315            LFCRLYFHAHYFSDVIGGTSLAIIWVALFLMVYPYFINHRRQRV
    NCTC8325        LFCRLYFHAHYFSDVIGGTSLAIIWVALFLMVYPYFINHRRQRV
    Newman          LFCRLYFHAHYFSDVIGGTSLAIIWVALFLMVYPYFINHRRQRV
    USA300_FPR3757  LFCRLYFHAHYFSDVIGGTSLAIIWVALFLMVYPYFINHRRQRV
                    ********************************************