From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002170000
  • symbol?:
  • description?: carboxylesterase

      descriptions from strain specific annotations:

    • carboxylesterase
    • dienelactone hydrolase family protein
    • esterase/lipase
    • Esterase/lipase family protein
    • lipase/esterase
    • peptidase
    • S33 family peptidase
  • strand?: +
  • coordinates?: 2675181..2675933
  • synteny block?: BlockID0014710
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0433
    08BA02176:
    C248_0507
    11819-97:
    MS7_0430
    71193:
    ST398NM01_0523
    ECT-R 2:
    ECTR2_391
    ED133:
    SAOV_0474
    ED98:
    SAAV_0400
    HO 5096 0412:
    SAEMRSA15_03820
    JH1:
    SaurJH1_0492
    JH9:
    SaurJH9_0479
    JKD6008:
    SAA6008_00460
    JKD6159:
    SAA6159_00407
    LGA251:
    SARLGA251_03910
    M013:
    M013TW_0421
    MRSA252:
    SAR0457
    MSHR1132:
    SAMSHR1132_04020
    MSSA476:
    SAS0415
    Mu3:
    SAHV_0455
    Mu50:
    SAV0457
    MW2:
    MW0411
    RF122:
    SAB0407
    ST398:
    SAPIG0523
    T0131:
    SAT0131_00495
    TCH60:
    HMPREF0772_10065 (est)
    TW20:
    SATW20_05260
    USA300_TCH1516:
    USA300HOU_0462
    VC40:
    SAVC_01870

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFSCYAPNYPGHGLLLKD
    N315            MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFSCYAPNYPGHGLLLKD
    NCTC8325        MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFSCYAPNYPGHGLLLKD
    Newman          MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFSCYAPNYPGHGLLLKD
    USA300_FPR3757  MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFSCYAPNYPGHGLLLKD
                    ************************************************************

    COL             FMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQHYPLKRIAVMSAPKE
    N315            FMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQHYPLKRIAVMSAPKE
    NCTC8325        FMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQHYPLKRIAVMSAPKE
    Newman          FMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQHYPLKRIAVMSAPKE
    USA300_FPR3757  FMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQHYPLKRIAVMSAPKE
                    ************************************************************

    COL             KSDDGLIEHLVYYSQRMSNILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMTNLNVIK
    N315            KSDDGLIEHLVYYSQRMSNILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMTNLNVIK
    NCTC8325        KSDDGLIEHLVYYSQRMSNILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMTNLNVIK
    Newman          KSDDGLIEHLVYYSQRMSNILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMTNLNVIK
    USA300_FPR3757  KSDDGLIEHLVYYSQRMSNILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMTNLNVIK
                    ************************************************************

    COL             MPANILFGGKDAPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDILEENVIRFF
    N315            IPANILFGGKDEPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDILEENVIRFF
    NCTC8325        MPANILFGGKDAPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDILEENVIRFF
    Newman          MPANILFGGKDAPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDILEENVIRFF
    USA300_FPR3757  MPANILFGGKDAPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDILEENVIRFF
                    :********** ************************************************

    COL             NALT
    N315            NALT
    NCTC8325        NALT
    Newman          NALT
    USA300_FPR3757  NALT
                    ****