Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002173000
  • symbol?:
  • description?: sodium-dependent transporter

      descriptions from strain specific annotations:

    • sodium-dependent transporter
    • sodium-dependent transporter, putative
    • sodium:neurotransmitter symporter
    • sodium:neurotransmitter symporter family protein
    • sodium-dependent symporter protein
    • Transporter
    • Sodium/neurotransmitter symporter family protein
  • strand?: +
  • coordinates?: 2676501..2677841
  • synteny block?: BlockID0014740
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0434
    08BA02176:
    C248_0508
    11819-97:
    MS7_0432
    71193:
    ST398NM01_0524
    ECT-R 2:
    ECTR2_392
    ED133:
    SAOV_0476
    ED98:
    SAAV_0401
    HO 5096 0412:
    SAEMRSA15_03840
    JH1:
    SaurJH1_0493
    JH9:
    SaurJH9_0480
    JKD6008:
    SAA6008_00462
    JKD6159:
    SAA6159_00408
    LGA251:
    SARLGA251_03920
    M013:
    M013TW_0423
    MRSA252:
    SAR0458
    MSHR1132:
    SAMSHR1132_04030
    MSSA476:
    SAS0416
    Mu3:
    SAHV_0456
    Mu50:
    SAV0458
    MW2:
    MW0413
    RF122:
    SAB0408
    ST398:
    SAPIG0524
    T0131:
    SAT0131_00498
    TCH60:
    HMPREF0772_10064
    TW20:
    SATW20_05270
    USA300_TCH1516:
    VC40:
    SAVC_01880

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MKRQQSQWKSSTGFILASAGSAIGLGAMWKFPYMAGIYGGGAFLAMFLIFTIFVGLPLL
    N315            MMKRQQSQWKSSTGFILASAGSAIGLGAMWKFPYMAGIYGGGAFLAMFLIFTIFVGLPLL
    NCTC8325        -MKRQQSQWKSSTGFILASAGSAIGLGAMWKFPYMAGIYGGGAFLAMFLIFTIFVGLPLL
    Newman          MMKRQQSQWKSSTGFILASAGSAIGLGAMWKFPYMAGIYGGGAFLAMFLIFTIFVGLPLL
    USA300_FPR3757  -MKRQQSQWKSSTGFILASAGSAIGLGAMWKFPYMAGIYGGGAFLAMFLIFTIFVGLPLL
                     ***********************************************************

    COL             IMEFTVGKMGRTYTTQIYSKLTGKKWLNIIGWNGNLAVFILFGFYSVIGGWIVIYIGQVL
    N315            IMEFTVGKMGRTYTTQIYSKLTGKKWLNIIGWNGNLAVFILFGFYSVIGGWIVIYIGQVL
    NCTC8325        IMEFTVGKMGRTYTTQIYSKLTGKKWLNIIGWNGNLAVFILFGFYSVIGGWIVIYIGQVL
    Newman          IMEFTVGKMGRTYTTQIYSKLTGKKWLNIIGWNGNLAVFILFGFYSVIGGWIVIYIGQVL
    USA300_FPR3757  IMEFTVGKMGRTYTTQIYSKLTGKKWLNIIGWNGNLAVFILFGFYSVIGGWIVIYIGQVL
                    ************************************************************

    COL             WQLVIFQRINHLQEMNFEAVISNPWLTVLGQGIFIFATMIIVMLGVEKGLEKASKVMMPL
    N315            WQLVIFQRINHLQEMNFEAVISNPWLTVLGQGIFIFATMIIVMLGVEKGLEKASKVMMPL
    NCTC8325        WQLVIFQRINHLQEMNFEAVISNPWLTVLGQGIFIFATMIIVMLGVEKGLEKASKVMMPL
    Newman          WQLVIFQRINHLQEMNFEAVISNPWLTVLGQGIFIFATMIIVMLGVEKGLEKASKVMMPL
    USA300_FPR3757  WQLVIFQRINHLQEMNFEAVISNPWLTVLGQGIFIFATMIIVMLGVEKGLEKASKVMMPL
                    ************************************************************

    COL             LFVFLIVIVIKSLTLDGALEGVKFILQPRVSEITADGILFALGQSFFTLSLGTTGMITYA
    N315            LFVFLIIIVIKSLTLDGALEGVKFILQPRVSEITADGILFALGQSFFTLSLGTTGMITYA
    NCTC8325        LFVFLIVIVIKSLTLDGVLEGVKFILQPRVSEITADGILFALGQSFFTLSLGTTGMITYA
    Newman          LFVFLIVIVIKSLTLDGALEGVKFILQPRVSEITADGILFALGQSFFTLSLGTTGMITYA
    USA300_FPR3757  LFVFLIVIVIKSLTLDGALEGVKFILQPRVSEITADGILFALGQSFFTLSLGTTGMITYA
                    ******:**********.******************************************

    COL             SYASKDMTIKSSAISIVVMNIFVSVLAGLAIFPALHSFGYEPQEGPGLLFKVLPMVFSQM
    N315            SYASKDMTIKSSAISIVVMNIFVSVLAGLAIFPALHSFGYEPQEGPGLLFKVLPMVFSQM
    NCTC8325        SYASKDMTIKSSAISIVVMNIFVSVLAGLAIFPALHSFGYEPQEGPGLLFKVLPMVFSQM
    Newman          SYASKDMTIKSSAISIVVMNIFVSVLAGLAIFPALHSFGYEPQEGPGLLFKVLPMVFSQM
    USA300_FPR3757  SYASKDMTIKSSAISIVVMNIFVSVLAGLAIFPALHSFGYEPQEGPGLLFKVLPMVFSQM
                    ************************************************************

    COL             HLGTLFYLGFLVLFLFAALTSSISLLELNVSNFTKNDNTKRKKVAVIGSILVFIISIPAT
    N315            HLGTLFYLGFLVLFLFAALTSSISLLELNVSNFTKNDNTKRKKVAVIGSILVFIISIPAT
    NCTC8325        HLGTLFYLGFLVLFLFAALTSSISLLELNVSNFTKNDNTKRKKVAVIGSILVFIISIPAT
    Newman          HLGTLFYLGFLVLFLFAALTSSISLLELNVSNFTKNDNTKRKKVAVIGSILVFIISIPAT
    USA300_FPR3757  HLGTLFYLGFLVLFLFAALTSSISLLELNVSNFTKNDNTKRKKVAVIGSILVFIISIPAT
                    ************************************************************

    COL             LSFGILKDVRFGAGTIFDNMDFIVSNVLMPLGALGTTLVVGQLLDKKLLQQYFGKDRFRL
    N315            LSFGILKDVRFGAGTIFDNMDFIVSNVLMPLGALGTTLVIGQLLDKKLLQQYFGKDRFRL
    NCTC8325        LSFGILKDVRFGAGTIFDNMDFIVSNVLMPLGALGTTLVVGQLLDKKLLQQYFGKDRFRL
    Newman          LSFGILKDVRFGAGTIFDNMDFIVSNVLMPLGALGTTLVVGQLLDKKLLQQYFGKDRFRL
    USA300_FPR3757  LSFGILKDVRFGAGTIFDNMDFIVSNVLMPLGALGTTLVVGQLLDKKLLQQYFGKDRFRL
                    ***************************************:********************

    COL             FSGWYYLIKYAMPVVIILVFIVQLFS
    N315            FNGWYYLIKYAMPVVIILVFIVQLFS
    NCTC8325        FSGWYYLIKYAMPVVIILVFIVQLFS
    Newman          FSGWYYLIKYAMPVVIILVFIVQLFS
    USA300_FPR3757  FSGWYYLIKYAMPVVIILVFIVQLFS
                    *.************************