From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002174000
  • symbol?: mccA
  • description?: cysteine synthase

      descriptions from strain specific annotations:

    • cysteine synthase
    • cysteine synthase/cystathionine beta-synthase
    • Cystathionine beta-synthase
    • Cystathionine beta-synthase, CysM
    • cysteine synthase (O-acetylserine sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase)
    • cysteine synthase (O-acetylserine sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase) (Superoxide-inducible protein 11)(SOI11)
    • cysteine synthase/cystathionine beta-synthase family protein
    • cysteine synthase homologue
    • cysteine synthase-like protein
    • O-acetylserine dependent cystathionine beta-synthase
    • pyridoxal-5'-phosphate-dependent protein beta subunit
    • pyridoxal-5'-phosphate-dependent protein subunit beta
    • pyridoxal-phosphate dependent protein
  • strand?: +
  • coordinates?: 2678008..2678966
  • synteny block?: BlockID0014750
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0418 (cysM)
    NCTC8325:
    Newman:
    NWMN_0424 (cysM)
    USA300_FPR3757:
    04-02981:
    SA2981_0435 (cysM)
    08BA02176:
    C248_0509
    11819-97:
    MS7_0433 (mccA)
    71193:
    ST398NM01_0525
    ECT-R 2:
    ECTR2_393
    ED133:
    SAOV_0477
    ED98:
    SAAV_0402
    HO 5096 0412:
    SAEMRSA15_03850
    JH1:
    SaurJH1_0494
    JH9:
    SaurJH9_0481
    JKD6008:
    SAA6008_00463 (cysM)
    JKD6159:
    SAA6159_00409 (cysM)
    LGA251:
    SARLGA251_03930
    M013:
    M013TW_0424
    MRSA252:
    SAR0459
    MSHR1132:
    SAMSHR1132_04040
    MSSA476:
    SAS0417
    Mu3:
    SAHV_0457 (cysM)
    Mu50:
    SAV0459 (cysM)
    MW2:
    MW0414 (cysM)
    RF122:
    SAB0409
    ST398:
    SAPIG0525
    T0131:
    SAT0131_00499
    TCH60:
    HMPREF0772_10063 (cysM)
    TW20:
    SATW20_05280
    USA300_TCH1516:
    VC40:
    SAVC_01885

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MITYDLIGNTPLVLLEHYSDDKVKIYAKLEQWNPGGSVKDRLGKYLVEKAIQEGRVRAGQ
    N315            MITYDLIGNTPLVLLEHYSDDKVKIYAKLEQWNPGGSVKDRLGKYLVEKAIQEGRVRAGQ
    NCTC8325        MITYDLIGNTPLVLLEHYSDDKVKIYAKLEQWNPGGSVKDRLGKYLVEKAIQEGRVRAGQ
    Newman          MITYDLIGNTPLVLLEHYSDDKVKIYAKLEQWNPGGSVKDRLGKYLVEKAIQEGRVRAGQ
    USA300_FPR3757  MITYDLIGNTPLVLLEHYSDDKVKIYAKLEQWNPGGSVKDRLGKYLVEKAIQEGRVRAGQ
                    ************************************************************

    COL             TIVEATAGNTGIGLAIAANRHHLKCKIFAPYGFSEEKINIMIALGAEVSRTSQSEGMHGA
    N315            TIVEATAGNTGIGLAIAANRHHLKCKIFAPYGFSEEKINIMIALGADVSRTSQSEGMHGA
    NCTC8325        TIVEATAGNTGIGLAIAANRHHLKCKIFAPYGFSEEKINIMIALGAEVSRTSQSEGMHGA
    Newman          TIVEATAGNTGIGLAIAANRHHLKCKIFAPYGFSEEKINIMIALGAEVSRTSQSEGMHGA
    USA300_FPR3757  TIVEATAGNTGIGLAIAANRHHLKCKIFAPYGFSEEKINIMIALGAEVSRTSQSEGMHGA
                    **********************************************:*************

    COL             QLAARSYAEKYGAVYMNQFESEHNPDTYFHTLGPELTSALQQIDYFVAGIGSGGTFTGTA
    N315            QLAARSYAEKYGAVYMNQFESEHNPDTYFHTLGPELTSALQQIDYFVAGIGSGGTFTGTA
    NCTC8325        QLAARSYAEKYGAVYMNQFESEHNPDTYFHTLGPELTSALQQIDYFVAGIGSGGTFTGTA
    Newman          QLAARSYAEKYGAVYMNQFESEHNPDTYFHTLGPELTSALQQIDYFVAGIGSGGTFTGTA
    USA300_FPR3757  QLAARSYAEKYGAVYMNQFESEHNPDTYFHTLGPELTSALQQIDYFVAGIGSGGTFTGTA
                    ************************************************************

    COL             RYLKQHHVQCYAVEPEGSVLNGGPAHAHDTEGIGSEKWPIFLERRLVDGIFTIKDQDAFR
    N315            RYLKQHHVQCYAVEPEGSVLNGGPAHAHDTEGIGSEKWPIFLERRLVDGIFTIKDQDAFR
    NCTC8325        RYLKQHHVQCYAVEPEGSVLNGGPAHAHDTEGIGSEKWPIFLERRLVDGIFTIKDQDAFR
    Newman          RYLKQHHVQCYAVEPEGSVLNGGPAHAHDTEGIGSEKWPIFLERRLVDGIFTIKDQDAFR
    USA300_FPR3757  RYLKQHHVQCYAVEPEGSVLNGGPAHAHDTEGIGSEKWPIFLERRLVDGIFTIKDQDAFR
                    ************************************************************

    COL             NVKSLAINEGLLVGSSSGAALQGALNLKAQLSEGTIVVVFPDGSDRYMSKQIFNYEENNN
    N315            NVKSLAINEGLLVGSSSGAALQGALNLKAQLSEGTIVVVFPDGSDRYMSKQIFNYEENDY
    NCTC8325        NVKSLAINEGLLVGSSSGAALQGALNLKAQLSEGTIVVVFPDGSDRYMSKQIFNYEENNN
    Newman          NVKSLAINEGLLVGSSSGAALQGALNLKAQLSEGTIVVVFPDGSDRYMSKQIFNYEENNN
    USA300_FPR3757  NVKSLAINEGLLVGSSSGAALQGALNLKAQLSEGTIVVVFPDGSDRYMSKQIFNYEENNN
                    **********************************************************: 

    COL             EQEN
    N315            E---
    NCTC8325        EQEN
    Newman          EQEN
    USA300_FPR3757  EQEN
                    *