From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002175000
  • symbol?: mccB
  • description?: cystathionine gamma-synthase

      descriptions from strain specific annotations:

    • cystathionine gamma-synthase
    • trans-sulfuration enzyme family protein
    • Cystathionine gamma-lyase
    • putative Cys/Met metabolism PLP-dependentenzyme
    • bifunctional cystathionine gamma-lyase/gamma-synthase
    • Cys/Met metabolism PLP-dependent enzyme
    • cystathionine beta-lyase
    • cystathionine gamma-lyase (Gamma-cystathionase)(Probasin-related antigen) (PRB-RA)
    • cystathionine gamma-synthase (CGS) (O-succinylhomoserine(thiol)-lyase)
    • cystathionine gamma-synthase-like protein
  • strand?: +
  • coordinates?: 2678887..2680101
  • synteny block?: BlockID0014760
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0419 (metB)
    NCTC8325:
    Newman:
    NWMN_0425 (metB)
    USA300_FPR3757:
    04-02981:
    SA2981_0436 (metB)
    08BA02176:
    C248_0510
    11819-97:
    MS7_0434 (mccB)
    71193:
    ST398NM01_0526
    ECT-R 2:
    ECTR2_394
    ED133:
    SAOV_0478
    ED98:
    SAAV_0403
    HO 5096 0412:
    SAEMRSA15_03860
    JH1:
    SaurJH1_0495
    JH9:
    SaurJH9_0482
    JKD6008:
    SAA6008_00464 (metB)
    JKD6159:
    SAA6159_00410 (metB)
    LGA251:
    SARLGA251_03940
    M013:
    M013TW_0425
    MRSA252:
    SAR0460
    MSHR1132:
    SAMSHR1132_04050
    MSSA476:
    SAS0418
    Mu3:
    SAHV_0458 (yrhB)
    Mu50:
    SAV0460 (yrhB)
    MW2:
    MW0415 (metB)
    RF122:
    SAB0410
    ST398:
    SAPIG0526
    T0131:
    SAT0131_00500
    TCH60:
    HMPREF0772_10062 (metC)
    TW20:
    SATW20_05290
    USA300_TCH1516:
    VC40:
    SAVC_01890

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKKTKLIHGGHTTDDYTGAVTTPIYQTSTYLQDDIGDLRQGYEYSRTANPTRSSVESVI
    N315            MNKKTKLIHGGHTTDDYTGAVTTPIYQTSTYLQDDIGDLRQGYEYSRTANPTRSSVESVI
    NCTC8325        MNKKTKLIHGGHTTDDYTGAVTTPIYQTSTYLQDDIGDLRQGYEYSRTANPTRSSVESVI
    Newman          MNKKTKLIHGGHTTDDYTGAVTTPIYQTSTYLQDDIGDLRQGYEYSRTANPTRSSVESVI
    USA300_FPR3757  MNKKTKLIHGGHTTDDYTGAVTTPIYQTSTYLQDDIGDLRQGYEYSRTANPTRSSVESVI
                    ************************************************************

    COL             ATLENGKHGFAFSSGVAAISAVVMLLDKGDHIILNSDVYGGTYRALTKVFTRFGIEVDFV
    N315            AALENGKHGFAFSSGVAAISAVVMLLDKGDHIILNSDVYGGTYRALTKVFTRFGIEVDFV
    NCTC8325        ATLENGKHGFAFSSGVAAISAVVMLLDKGDHIILNSDVYGGTYRALTKVFTRFGIEVDFV
    Newman          ATLENGKHGFAFSSGVAAISAVVMLLDKGDHIILNSDVYGGTYRALTKVFTRFGIEVDFV
    USA300_FPR3757  ATLENGKHGFAFSSGVAAISAVVMLLDKGDHIILNSDVYGGTYRALTKVFTRFGIEVDFV
                    *:**********************************************************

    COL             DTTHTDSIVQAIRPTTKMLFIETPSNPLLRVTDIKKSAEIAKEHGLISVVDNTFMTPYYQ
    N315            DTTHTDSIVQAIRPTTKMLFIETPSNPLLRVTDIKKSAEIAKEHGLISVVDNTFMTPYYQ
    NCTC8325        DTTHTDSIVQAIRPTTKMLFIETPSNPLLRVTDIKKSAEIAKEHGLISVVDNTFMTPYYQ
    Newman          DTTHTDSIVQAIRPTTKMLFIETPSNPLLRVTDIKKSAEIAKEHGLISVVDNTFMTPYYQ
    USA300_FPR3757  DTTHTDSIVQAIRPTTKMLFIETPSNPLLRVTDIKKSAEIAKEHGLISVVDNTFMTPYYQ
                    ************************************************************

    COL             NPLDLGIDIVLHSATKYLGGHSDVVAGLVATSDDKLAERLAFISNSTGGILGPQDSYLLV
    N315            NPLDLGIDIVLHSATKYLGGHSDVVAGLVATSDDKLAERLAFISNSTGGILGPQDSYLLV
    NCTC8325        NPLDLGIDIVLHSATKYLGGHSDVVAGLVATSDDKLAERLAFISNSTGGILGPQDSYLLV
    Newman          NPLDLGIDIVLHSATKYLGGHSDVVAGLVATSDDKLAERLAFISNSTGGILGPQDSYLLV
    USA300_FPR3757  NPLDLGIDIVLHSATKYLGGHSDVVAGLVATSDDKLAERLAFISNSTGGILGPQDSYLLV
                    ************************************************************

    COL             RGIKTLGLRMEQINRSVIEIIKMLQAHPAVQQVFHPSIESHLNHDVHMAQADGHTGVIAF
    N315            RGIKTLGLRMEQINRSVIEIIKMLQAHPAVQQVFHPSIESHLNHDVHMAQADGHTGVIAF
    NCTC8325        RGIKTLGLRMEQINRSVIEIIKMLQAHPAVQQVFHPSIESHLNHDVHMAQADGHTGVIAF
    Newman          RGIKTLGLRMEQINRSVIEIIKMLQAHPAVQQVFHPSIESHLNHDVHMAQADGHTGVIAF
    USA300_FPR3757  RGIKTLGLRMEQINRSVIEIIKMLQAHPAVQQVFHPSIESHLNHDVHMAQADGHTGVIAF
                    ************************************************************

    COL             EVKNTESAKQLIKATSYYTLAESLGAVESLISVPALMTHASIPADIRAKEGITDGLVRIS
    N315            EVKNTESAKQLIKATSYYTLAESLGAVESLISVPALMTHASIPADIRAKEGITDGLVRIS
    NCTC8325        EVKNTESAKQLIKATSYYTLAESLGAVESLISVPALMTHASIPADIRAKEGITDGLVRIS
    Newman          EVKNTESAKQLIKATSYYTLAESLGAVESLISVPALMTHASIPADIRAKEGITDGLVRIS
    USA300_FPR3757  EVKNTESAKQLIKATSYYTLAESLGAVESLISVPALMTHASIPADIRAKEGITDGLVRIS
                    ************************************************************

    COL             VGIEDTEDLVDDLKQALDTL
    N315            VGIEDTEDLVDDLKQALDTL
    NCTC8325        VGIEDTEDLVDDLKQALDTL
    Newman          VGIEDTEDLVDDLKQALDTL
    USA300_FPR3757  VGIEDTEDLVDDLKQALDTL
                    ********************