From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002177000
  • symbol?: metP2
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • D-methionine transport system permease protein metI
    • ABC transporter ATP-binding protein
    • binding--dependent transport system inner membrane component family protein
    • binding-protein-dependent transport system inner membrane protein
    • metal ion ABC superfamily ATP binding cassette transporter, membrane protein
    • methionine ABC transporter permease
    • Methionine ABC transporter permease protein
    • putative transport system membrane protein
  • strand?: +
  • coordinates?: 2681462..2682121
  • synteny block?: BlockID0014780
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0438
    08BA02176:
    C248_0512
    11819-97:
    MS7_0436
    71193:
    ST398NM01_0528
    ECT-R 2:
    ECTR2_396
    ED133:
    SAOV_0480
    ED98:
    SAAV_0405
    HO 5096 0412:
    SAEMRSA15_03880
    JH1:
    SaurJH1_0497
    JH9:
    SaurJH9_0484
    JKD6008:
    SAA6008_00466
    JKD6159:
    SAA6159_00412
    LGA251:
    SARLGA251_03960
    M013:
    M013TW_0427
    MRSA252:
    SAR0462
    MSHR1132:
    SAMSHR1132_04070
    MSSA476:
    SAS0420
    Mu3:
    SAHV_0460
    Mu50:
    SAV0463
    MW2:
    MW0417
    RF122:
    SAB0412
    ST398:
    SAPIG0528
    T0131:
    SAT0131_00502
    TCH60:
    HMPREF0772_10060 (metI)
    TW20:
    SATW20_05310
    USA300_TCH1516:
    VC40:
    SAVC_01900

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFGSDLDSAQLLQALYETLYMVSIALFLGAVIGIPLGVLLVITRKQGIWPNIVIHQVLNP
    N315            MFGSDLDSAQLLQALYETLYMVSIALFLGAVIGIPLGVLLVITRKQGIWPNIVIHQVLNP
    NCTC8325        MFGSDLDSAQLLQALYETLYMVSIALFLGAVIGIPLGVLLVITRKQGIWPNIVIHQVLNP
    Newman          MFGSDLDSAQLLQALYETLYMVSIALFLGAVIGIPLGVLLVITRKQGIWPNIVIHQVLNP
    USA300_FPR3757  MFGSDLDSAQLLQALYETLYMVSIALFLGAVIGIPLGVLLVITRKQGIWPNIVIHQVLNP
                    ************************************************************

    COL             LINILRSLPFIILLIAIVPFTKLVVGTSIGTTAAIVPLTVYVAPYIARLVENSLLEVDEG
    N315            LINILRSLPFIILLIAIVPFTKLVVGTSIGTTAAIVPLTVYVAPYIARLVENSLLEVDEG
    NCTC8325        LINILRSLPFIILLIAIVPFTKLVVGTSIGTTAAIVPLTVYVAPYIARLVENSLLEVDEG
    Newman          LINILRSLPFIILLIAIVPFTKLVVGTSIGTTAAIVPLTVYVAPYIARLVENSLLEVDEG
    USA300_FPR3757  LINILRSLPFIILLIAIVPFTKLVVGTSIGTTAAIVPLTVYVAPYIARLVENSLLEVDEG
                    ************************************************************

    COL             IIEAAKAMGASPLQIIRYFLIPEALGSLVLAITTAIIGLIGSTAMAGAVGGGGIGDLALV
    N315            IIEAAKAMGASPLQIIRYFLIPEALGSLVLAITTAIIGLIGSTAMAGAVGGGGIGDLALV
    NCTC8325        IIEAAKAMGASPLQIIRYFLIPEALGSLVLAITTAIIGLIGSTAMAGAVGGGGIGDLALV
    Newman          IIEAAKAMGASPLQIIRYFLIPEALGSLVLAITTAIIGLIGSTAMAGAVGGGGIGDLALV
    USA300_FPR3757  IIEAAKAMGASPLQIIRYFLIPEALGSLVLAITTAIIGLIGSTAMAGAVGGGGIGDLALV
                    ************************************************************

    COL             YGYQRFDTTVIIITVIVLVIIVQVIQTLGNVLARFIRRH
    N315            YGYQRFDTTVIIITVIVLVIIVQVIQTLGNVLARFIRRH
    NCTC8325        YGYQRFDTTVIIITVIVLVIIVQVIQTLGNVLARFIRRH
    Newman          YGYQRFDTTVIIITVIVLVIIVQVIQTLGNVLARFIRRH
    USA300_FPR3757  YGYQRFDTTVIIITVIVLVIIVQVIQTLGNVLARFIRRH
                    ***************************************