From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002215000
  • symbol?:
  • description?: lysine decarboxylase

      descriptions from strain specific annotations:

    • lysine decarboxylase
    • Orn/Lys/Arg decarboxylase, major region
    • Orn/Lys/Arg decarboxylase major region
    • Arginine decarboxylase / Lysine decarboxylase
    • Orn/Lys/Arg decarboxylase family protein
    • arginine/lysine/ornithine decarboxylase
    • Orn/Lys/Arg decarboxylase, putative
    • orn/Lys/Arg decarboxylase, major domain protein
    • arginine decarboxylase
  • strand?: +
  • coordinates?: 2729378..2730715
  • synteny block?: BlockID0015140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0445 (tmk)
    USA300_FPR3757:
    04-02981:
    SA2981_0456
    08BA02176:
    C248_0535
    11819-97:
    MS7_0458
    71193:
    ST398NM01_0547
    ECT-R 2:
    ECTR2_421
    ED133:
    SAOV_0502
    ED98:
    SAAV_0427
    HO 5096 0412:
    SAEMRSA15_04070
    JH1:
    SaurJH1_0515
    JH9:
    SaurJH9_0502
    JKD6008:
    SAA6008_00485 (ldcC)
    JKD6159:
    SAA6159_00432 (ldcC)
    LGA251:
    SARLGA251_04150
    M013:
    M013TW_0450
    MRSA252:
    SAR0482
    MSHR1132:
    SAMSHR1132_04250
    MSSA476:
    SAS0438
    Mu3:
    SAHV_0478
    Mu50:
    SAV0481
    MW2:
    MW0436
    RF122:
    SAB0430
    ST398:
    SAPIG0547
    T0131:
    SAT0131_00524 (putA)
    TCH60:
    HMPREF0772_10040
    TW20:
    SATW20_05490
    USA300_TCH1516:
    USA300HOU_0480
    VC40:
    SAVC_01990

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQPILNKLESLNQEEAISLHVPGHKNMTIGHLSQLSMTMDKTEIPGLDDLHHPEEVILE
    N315            MKQPILNKLESLNQEEAISLHVPGHKNMTIGHLSQLSMTMDKTEIPGLDDLHHPEEVILE
    NCTC8325        MKQPILNKLESLNQEEAISLHVPGHKNMTIGHLSQLSMTMDKTEIPGLDDLHHPEEVILE
    Newman          MKQPILNKLESLNQEEAISLHVPGHKNMTIGHLSQLSMTMDKTEIPGLDDLHHPEEVILE
    USA300_FPR3757  MKQPILNKLESLNQEEAISLHVPGHKNMTIGHLSQLSMTMDKTEIPGLDDLHHPEEVILE
                    ************************************************************

    COL             SMKQVEKHSDYDAYFLVNGTTSGILSVIQSFSQKKGDILMARNVHKSVLHALDISQQEGH
    N315            SMKQVEKHSDYDAYFLVNGTTSGILSVIQSFSQKKGDILMARNVHKSVLHALDISQQEGH
    NCTC8325        SMKQVEKHSDYDAYFLVNGTTSGILSVIQSFSQKKGDILMARNVHKSVLHALDISQQEGH
    Newman          SMKQVEKHSDYDAYFLVNGTTSGILSVIQSFSQKKGDILMARNVHKSVLHALDISQQEGH
    USA300_FPR3757  SMKQVEKHSDYDAYFLVNGTTSGILSVIQSFSQKKGDILMARNVHKSVLHALDISQQEGH
                    ************************************************************

    COL             FIETHQSPLTNHYNKVNLSRLNNDGHKLAVLTYPNYYGETFNVEEVIKSLHQLNIPVLID
    N315            FIETHQSPLTNHYNKVNLSRLNNDGHKLAVLTYPNYYGETFNVEEVIKSLHQLNIPVLID
    NCTC8325        FIETHQSPLTNHYNKVNLSRLNNDGHKLAVLTYPNYYGETFNVEEVIKSLHQLNIPVLID
    Newman          FIETHQSPLTNHYNKVNLSRLNNDGHKLAVLTYPNYYGETFNVEEVIKSLHQLNIPVLID
    USA300_FPR3757  FIETHQSPLTNHYNKVNLSRLNNDGHKLAVLTYPNYYGETFNVEEVIKFLHQLNIPVLID
                    ************************************************ ***********

    COL             EAHGAHFGLQGFPDSTLNYQADYVVQSFHKTLPALTMGSVLYIHKNAPYRETIIEYLSYF
    N315            EAHGAHFGLQGFPDSTLNYQADYVVQSFHKTLPALTMGSVLYIHKNAPYRETIIEYLSYF
    NCTC8325        EAHGAHFGLQGFPDSTLNYQADYVVQSFHKTLPALTMGSVLYIHKNAPYRETIIEYLSYF
    Newman          EAHGAHFGLQGFPDSTLNYQADYVVQSFHKTLPALTMGSVLYIHKNAPYRETIIEYLSYF
    USA300_FPR3757  EAHGAHFGLQGFPDSTLNYQADYVVQSFHKTLPALTMGSVLYIHKNAPYRETIIEYLSYF
                    ************************************************************

    COL             QTSSPSYLIMASLESAAEFYKTYDSTVFFDKRAQLIECLEKKGFEMLQVDDPLKLLIKYE
    N315            QTSSPSYLIMASLESAAEFYKTYDSTVFFDKRAQLIECLEKKGFEMLQVDDPLKLLIKYE
    NCTC8325        QTSSPSYLIMASLESAAEFYKTYDSTVFFDKRAQLIECLEKKGFEMLQVDDPLKLLIKYE
    Newman          QTSSPSYLIMASLESAAEFYKTYDSTVFFDKRAQLIECLEKKGFEMLQVDDPLKLLIKYE
    USA300_FPR3757  QTSSPSYLIMASLESAAEFYKTYDSTVFFDKRAQLIECLEKKGFEMLQVDDPLKLLIKYE
                    ************************************************************

    COL             GFTGHDIQNWFMNAHIYLELADDYQALAILPLWHHDDTYLFDSLLRKIEDMILPKKSVSK
    N315            GFTGHDIQNWFMNAHIYLELADDYQALAILPLWHHDDTYLFDLLLRKIEDMILPKKSVSK
    NCTC8325        GFTGHDIQNWFMNAHIYLELADDYQALAILPLWHHDDTYLFDSLLRKIEDMILPKKSVSK
    Newman          GFTGHDIQNWFMNAHIYLELADDYQALAILPLWHHDDTYLFDSLLRKIEDMILPKKSVSK
    USA300_FPR3757  GFTGHDIQNWFMNAHIYLELADDYQALAILPLWHHDDTYLFDSLLRKIEDMILPKKSVSK
                    ****************************************** *****************

    COL             VKQTQLLTTEGNYKPKRFEYVTWCDLKKAKGKVLARHIVPYPPGIPIIFKGETITENMIE
    N315            VKQTQLLTTEGNYKPKRFEYVTWCDLKKAKGKVLARHIVPYPPGIPIIFKGETITENMIE
    NCTC8325        VKQTQLLTTEGNYKPKRFEYVTWCDLKKAKGKVLARHIVPYPPGIPIIFKGETITENMIE
    Newman          VKQTQLLTTEGNYKPKRFEYVTWCDLKKAKGKVLARHIVPYPPGIPIIFKGETITENMIE
    USA300_FPR3757  VKQTQLLTTEGNYKPKRFEYVTWCDLKKAKGKVLARHIVPYPPGIPIIFKGETITENMIE
                    ************************************************************

    COL             LVNEYLETGMIVEGIKNNKILVEDE
    N315            LVNEYLETGMIVEGIKNNKILVEDE
    NCTC8325        LVNEYLETGMIVEGIKNNKILVEDE
    Newman          LVNEYLETGMIVEGIKNNKILVEDE
    USA300_FPR3757  LVNEYLETGMIVEGIKNNKILVEDE
                    *************************