From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002221000
  • symbol?:
  • description?: DNA replication intiation control protein YabA

      descriptions from strain specific annotations:

    • DNA replication intiation control protein YabA
    • DNA replication intitiation control protein YabA
    • DNA replication initiation control protein YabA
    • initiation-control protein YabA
  • strand?: +
  • coordinates?: 2733632..2734000
  • synteny block?: BlockID0015200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0461 (yabA)
    08BA02176:
    C248_0540
    11819-97:
    MS7_0463
    71193:
    ST398NM01_0552
    ECT-R 2:
    ECTR2_426
    ED133:
    SAOV_0507
    ED98:
    SAAV_0432
    HO 5096 0412:
    SAEMRSA15_04120
    JH1:
    SaurJH1_0520
    JH9:
    SaurJH9_0507
    JKD6008:
    SAA6008_00490
    JKD6159:
    SAA6159_00437
    LGA251:
    SARLGA251_04200
    M013:
    M013TW_0455
    MRSA252:
    SAR0487
    MSHR1132:
    SAMSHR1132_04300
    MSSA476:
    SAS0443
    Mu3:
    SAHV_0483
    Mu50:
    SAV0486
    MW2:
    MW0441
    RF122:
    SAB0435
    ST398:
    SAPIG0552
    T0131:
    SAT0131_00531
    TCH60:
    HMPREF0772_10035 (yabA)
    TW20:
    SATW20_05540
    USA300_TCH1516:
    USA300HOU_0485
    VC40:
    SAVC_02015

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------MDRNEIFEKIMRLEMNVNQLSKETSELKALAVELVEENVALQLENDNLKKVLG
    N315            MKEALLHLDRNEIFEKIMRLEMNVNQLSKETSELKAHAVELVEENVALQLENDNLKKVLG
    NCTC8325        -------MDRNEIFEKIMRLEMNVNQLSKETSELKALAVELVEENVALQLENDNLKKVLG
    Newman          -------MDRNEIFEKIMRLEMNVNQLSKETSELKALAVELVEENVALQLENDNLKKVLG
    USA300_FPR3757  -------MDRNEIFEKIMRLEMNVNQLSKETSELKALAVELVEENVALQLENDNLKKVLG
                           :**************************** ***********************

    COL             NDEPTTIDTANSKPAKAVKKPLPSKDNLAILYGEGFHICKGELFGKHRHGEDCLFCLEVL
    N315            NDEPTTIDTANSKPAKAVKKPLPSKDNLAILYGEGFHICKGELFGKHRHGEDCLFCLEVL
    NCTC8325        NDEPTTIDTANSKPAKAVKKPLPSKDNLAILYGEGFHICKGELFGKHRHGEDCLFCLEVL
    Newman          NDEPTTIDTANSKPAKAVKKPLPSKDNLAILYGEGFHICKGELFGKHRHGEDCLFCLEVL
    USA300_FPR3757  NDEPTTIDTANSKPAKAVKKPLPSKDNLAILYGEGFHICKGELFGKHRHGEDCLFCLEVL
                    ************************************************************

    COL             SD
    N315            SD
    NCTC8325        SD
    Newman          SD
    USA300_FPR3757  SD
                    **