From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002225000
  • symbol?: rsmI
  • description?: rRNA (cytidine-2'-O-)-methyltransferase

      descriptions from strain specific annotations:

    • rRNA (cytidine-2'-O-)-methyltransferase
    • tetrapyrrole methylase
    • tetrapyrrole (corrin/porphyrin) methylase family protein
    • tetrapyrrole methylase family protein
    • rRNA small subunit methyltransferase I
    • tetrapyrrole (Corrin/Porphyrin) Methylases family protein
    • tetrapyrrole (corrin/porphyrin) methyltransferase
    • Tetrapyrrole (Corrin-Porphyrin) methylase family protein UPF0011
    • uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase
    • uroporphyrin-III C/tetrapyrrole methyltransferase
  • strand?: +
  • coordinates?: 2735263..2736102
  • synteny block?: BlockID0015240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0464
    08BA02176:
    C248_0543
    11819-97:
    MS7_0466
    71193:
    ST398NM01_0555
    ECT-R 2:
    ECTR2_429
    ED133:
    SAOV_0510
    ED98:
    SAAV_0435
    HO 5096 0412:
    SAEMRSA15_04150
    JH1:
    SaurJH1_0523
    JH9:
    SaurJH9_0510
    JKD6008:
    SAA6008_00493
    JKD6159:
    SAA6159_00440
    LGA251:
    SARLGA251_04230
    M013:
    M013TW_0458
    MRSA252:
    SAR0490
    MSHR1132:
    SAMSHR1132_04330
    MSSA476:
    SAS0446
    Mu3:
    SAHV_0486
    Mu50:
    SAV0489
    MW2:
    MW0444
    RF122:
    SAB0438
    ST398:
    SAPIG0555
    T0131:
    SAT0131_00534
    TCH60:
    HMPREF0772_10032
    TW20:
    SATW20_05570
    USA300_TCH1516:
    USA300HOU_0489
    VC40:
    SAVC_02030

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAVLYLVGTPIGNLADITYRAVDVLKRVDMIACEDTRVTSKLCNHYDIPTPLKSYHEHNK
    N315            MAVLYLVGTPIGNLADITYRAVDVLKRVDMIACEDTRVTSKLCNHYDIPTPLKSYHEHNK
    NCTC8325        MAVLYLVGTPIGNLADITYRAVDVLKRVDMIACEDTRVTSKLCNHYDIPTPLKSYHEHNK
    Newman          MAVLYLVGTPIGNLADITYRAVDVLKRVDMIACEDTRVTSKLCNHYDIPTPLKSYHEHNK
    USA300_FPR3757  MAVLYLVGTPIGNLADITYRAVDVLKRVDMIACEDTRVTSKLCNHYDIPTPLKSYHEHNK
                    ************************************************************

    COL             DKQTAFIIEQLELGLDVALVSDAGLPLISDPGYELVVAAREANIKVETVPGPNAGLTALM
    N315            DKQTAFIIEQLELGLDVALVSDAGLPLISDPGYELVVAAREANIKVETVPGPNAGLTALM
    NCTC8325        DKQTAFIIEQLELGLDVALVSDAGLPLISDPGYELVVAAREANIKVETVPGPNAGLTALM
    Newman          DKQTAFIIEQLELGLDVALVSDAGLPLISDPGYELVVAAREANIKVETVPGPNAGLTALM
    USA300_FPR3757  DKQTAFIIEQLELGLDVALVSDAGLPLISDPGYELVVAAREANIKVETVPGPNAGLTALM
                    ************************************************************

    COL             ASGLPSYVYTFLGFLPRKEKEKSAVLEQRMHENSTLIIYESPHRVTDTLKTIAKIDATRQ
    N315            ASGLPSYVYTFLGFLPRKEKEKSAVLEQRMHENSTLIIYESPHRVTDTLKTIAKIDATRQ
    NCTC8325        ASGLPSYVYTFLGFLPRKEKEKSAVLEQRMHENSTLIIYESPHRVTDTLKTIAKIDATRQ
    Newman          ASGLPSYVYTFLGFLPRKEKEKSAVLEQRMHENSTLIIYESPHRVTDTLKTIAKIDATRQ
    USA300_FPR3757  ASGLPSYVYTFLGFLPRKEKEKSAVLEQRMHENSTLIIYESPHRVTDTLKTIAKIDATRQ
                    ************************************************************

    COL             VSLGRELTKKFEQIVTDDVTQLQALIQQGDVPLKGEFVILIEGAKANNEISWFDDLSINE
    N315            VSLGRELTKKFEQIVTDDVTQLQALIQQGDVPLKGEFVILIEGAKANNEISWFDDLSINE
    NCTC8325        VSLGRELTKKFEQIVTDDVTQLQALIQQGDVPLKGEFVILIEGAKANNEISWFDDLSINE
    Newman          VSLGRELTKKFEQIVTDDVTQLQALIQQGDVPLKGEFVILIEGAKANNEISWFDDLSINE
    USA300_FPR3757  VSLGRELTKKFEQIVTDDVTQLQALIQQGDVPLKGEFVILIEGAKANNEISWFDDLSINE
                    ************************************************************

    COL             HVDHYIQTSQMKPKQAIKKVAEERQLKTNEVYNIYHQIS
    N315            HVDHYIQTSQMKPKQAIKKVAEERQLKTNEVYNIYHQIS
    NCTC8325        HVDHYIQTSQMKPKQAIKKVAEERQLKTNEVYNIYHQIS
    Newman          HVDHYIQTSQMKPKQAIKKVAEERQLKTNEVYNIYHQIS
    USA300_FPR3757  HVDHYIQTSQMKPKQAIKKVAEERQLKTNEVYNIYHQIS
                    ***************************************