From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002246000
  • symbol?:
  • description?: nucleoside triphosphate pyrophosphohydrolase-like protein

      descriptions from strain specific annotations:

    • nucleoside triphosphate pyrophosphohydrolase-like protein
    • tetrapyrrole methylase
    • MazG nucleotide pyrophosphohydrolase
    • tetrapyrrole methyltransferase domain / Nucleoside triphosphate pyrophosphohydrolase MazG
    • tetrapyrrole (Corrin/Porphyrin) Methylases family protein
    • tetrapyrrole (corrin/porphyrin) methylase
    • putative tetrapyrrole (corrin/porphyrin)methylases
    • Tetrapyrrole methylase family protein
    • putative nucleoside triphosphate pyrophosphohydrolase
  • strand?: +
  • coordinates?: 2754553..2755749
  • synteny block?: BlockID0015450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0480 (mazG)
    08BA02176:
    C248_0561
    11819-97:
    MS7_0482
    71193:
    ST398NM01_0571
    ECT-R 2:
    ECTR2_445
    ED133:
    SAOV_0527
    ED98:
    SAAV_0452
    HO 5096 0412:
    SAEMRSA15_04310
    JH1:
    SaurJH1_0540
    JH9:
    SaurJH9_0527
    JKD6008:
    SAA6008_00510 (mazG_1)
    JKD6159:
    SAA6159_00456 (mazG_1)
    LGA251:
    SARLGA251_04390
    M013:
    M013TW_0477
    MRSA252:
    SAR0506
    MSHR1132:
    SAMSHR1132_04490
    MSSA476:
    SAS0462
    Mu3:
    SAHV_0502
    Mu50:
    SAV0505
    MW2:
    MW0460
    RF122:
    SAB0454
    ST398:
    SAPIG0571
    T0131:
    SAT0131_00551
    TCH60:
    HMPREF0772_10014
    TW20:
    SATW20_05730
    USA300_TCH1516:
    USA300HOU_0499
    VC40:
    SAVC_02110

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MAHTITIVGLGNYGIDDLPLGIYKFLKTQDKVYARTLDHPVIESLQDELTFQSFDHVYE
    N315            -MAHTITIVGLGNYGIDDLPLGIYKFLKTQDKVYARTLDHPVIESLQDELTFQSFDHVYE
    NCTC8325        -MAHTITIVGLGNYGIDDLPLGIYKFLKTQDKVYARTLDHPVIESLQDELTFQSFDHVYE
    Newman          MMAHTITIVGLGNYGIDDLPLGIYKFLKTQDKVYARTLDHPVIESLQDELTFQSFDHVYE
    USA300_FPR3757  -MAHTITIVGLGNYGIDDLPLGIYKFLKTQDKVYARTLDHPVIESLQDELTFQSFDHVYE
                     ***********************************************************

    COL             AHNQFEDVYIDIVAQLVEAANEKDIVYAVPGHPRVAETTTVKLLALAKDNTDIDVKVLGG
    N315            AHDQFEDVYNDIVAQLVEAANEKDIVYAVPGHPRVAETTTVKLLALAKDNTDIDVKVLGG
    NCTC8325        AHNQFEDVYIDIVAQLVEAANEKDIVYAVPGHPRVAETTTVKLLALAKDNTDIDVKVLGG
    Newman          AHNQFEDVYIDIVAQLVEAANEKDIVYAVPGHPRVAETTTVKLLALAKDNTDIDVKVLGG
    USA300_FPR3757  AHNQFEDVYIDIVAQLVEAANEKDIVYAVPGHPRVAETTTVKLLALAKDNTDIDVKVLGG
                    **:****** **************************************************

    COL             KSFIDDVFEAVNVDPNDGFTLLDATSLQEVTLNVRTHTLITQVYSAMVAANLKITLMERY
    N315            KSFIDDVFEAVNVDPNDGFTLLDATSLQEVILNVRTHTLITQVYSAMVAANLKITLMERY
    NCTC8325        KSFIDDVFEAVNVDPNDGFTLLDATSLQEVTLNVRTHTLITQVYSAMVAANLKITLMERY
    Newman          KSFIDDVFEAVNVDPNDGFTLLDATSLQEVTLNVRTHTLITQVYSAMVAANLKITLMERY
    USA300_FPR3757  KSFIDDVFEAVNVDPNDGFTLLDATSLQEVTLNVRTHTLITQVYSAMVAANLKITLMERY
                    ****************************** *****************************

    COL             PDDYPVQIVTGARSDGADNVVTCPLYELDHDENAFNNLTSVFVPKIITSTYLYHDFDFAT
    N315            PDDYPVQIVTGARSDGADNVVTCPLYELDHDENAFNNLTSVFVPKIITSTYLYHDFDFAT
    NCTC8325        PDDYPVQIVTGARSDGADNVVTCPLYELDHDENAFNNLTSVFVPKIITSTYLYHDFDFAT
    Newman          PDDYPVQIVTGARSDGADNVVTCPLYELDHDENAFNNLTSVFVPKIITSTYLYHDFDFAT
    USA300_FPR3757  PDDYPVQIVTGARSDGADNVVTCPLYELDHDENAFNNLTSVFVPKIITSTYLYHDFDFAT
                    ************************************************************

    COL             EVIDTLVDEDKGCPWDKVQTHETLKRYLLEETFELFEAIDNEDDWHMIEELGDILLQVLL
    N315            EVIDTLVDEDKGCPWDKVQTHETLKRYLLEETFELFEAIDNEDDWHMIEELGDILLQVLL
    NCTC8325        EVIDTLVDEDKGCPWDKVQTHETLKRYLLEETFELFEAIDNEDDWHMIEELGDILLQVLL
    Newman          EVIDTLVDEDKGCPWDKVQTHETLKRYLLEETFELFEAIDNEDDWHMIEELGDILLQVLL
    USA300_FPR3757  EVIDTLVDEDKGCPWDKVQTHETLKRYLLEETFELFEAIDNEDDWHMIEELGDILLQVLL
                    ************************************************************

    COL             HTSIGKKEGYIDIKEVITSLNAKMIRRHPHIFGDANAETIDDLKEIWSKAKDAEGKQPRV
    N315            HTSIGKKEGYIDIKEVITSLNAKMIRRHPHIFGDANAETIDDLKEIWSKAKDAEGKQPRV
    NCTC8325        HTSIGKKEGYIDIKEVITSLNAKMIRRHPHIFGDANAETIDDLKEIWSKAKDAEGKQPRV
    Newman          HTSIGKKEGYIDIKEVITSLNAKMIRRHPHIFGDANAETIDDLKEIWSKAKDAEGKQPRV
    USA300_FPR3757  HTSIGKKEGYIDIKEVITSLNAKMIRRHPHIFGDANAETIDDLKEIWSKAKDAEGKQPRV
                    ************************************************************

    COL             KFEKVFAEHFLNLYEKTKDKSFDEAALKQWLEKGESNT
    N315            KFEKVFAEHFLNLYEKTKDKSFDEASLKQWLEKGESNT
    NCTC8325        KFEKVFAEHFLNLYEKTKDKSFDEAALKQWLEKGESNT
    Newman          KFEKVFAEHFLNLYEKTKDKSFDEAALKQWLEKGESNT
    USA300_FPR3757  IFEKVFAEHFLNLYEKTKDKSFDEAALKQWLEKGESNT
                     ************************:************