From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002288000
  • symbol?: mcsA
  • description?: uvrB/uvrC motif family protein

      descriptions from strain specific annotations:

    • uvrB/uvrC motif family protein
    • Nucleotide excision repair protein, with UvrB/UvrC motif
    • UvrB/UvrC motif-containing protein
    • UvrB/UvrC protein
    • modulator of heat shock repressor CtsR
    • UvrB/UvrC motif domain protein
    • UvrB/UvrC domain protein
    • ClpC ATPase
  • strand?: +
  • coordinates?: 2809119..2809685
  • synteny block?: BlockID0015870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0498
    08BA02176:
    C248_0595
    11819-97:
    MS7_0512
    71193:
    ST398NM01_0598
    ECT-R 2:
    ECTR2_476
    ED133:
    SAOV_0558
    ED98:
    SAAV_0484
    HO 5096 0412:
    SAEMRSA15_04490
    JH1:
    SaurJH1_0559
    JH9:
    SaurJH9_0545
    JKD6008:
    SAA6008_00529
    JKD6159:
    SAA6159_00476 (cstR)
    LGA251:
    SARLGA251_04580
    M013:
    M013TW_0507
    MRSA252:
    SAR0526
    MSHR1132:
    SAMSHR1132_04670
    MSSA476:
    SAS0480
    Mu3:
    SAHV_0520
    Mu50:
    SAV0523
    MW2:
    MW0478
    RF122:
    SAB0473
    ST398:
    SAPIG0598
    T0131:
    SAT0131_00573
    TCH60:
    HMPREF0772_12668
    TW20:
    SATW20_05920
    USA300_TCH1516:
    USA300HOU_0516
    VC40:
    SAVC_02200

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLCENCQLNEAELKVKVTSKNKTEEKMVCQTCAEGHHPWNQANEQPEYQEHQDNFEEAFV
    N315            MLCENCQLNEAELKVKVTSKNKTEEKMVCQTCAEGHHPWNQANEQPEYQEHQDNFEEAFV
    NCTC8325        --------------------------MVCQTCAEGHHPWNQANEQPEYQEHQDNFEEAFV
    Newman          --------------------------MVCQTCAEGHHPWNQANEQPEYQEHQDNFEEAFV
    USA300_FPR3757  --------------------------MVCQTCAEGHHPWNQANEQPEYQEHQDNFEEAFV
                                              **********************************

    COL             VKQILQHLATKHGINFQEVAFKEEKRCPSCHMTLKDIAHVGKFGCANCYATFKDDIIDIV
    N315            VKQILQHLATKHGINFQEVAFKEEKRCPSCHMTLKDIAHVGKFGCANCYATFKDDIIDIV
    NCTC8325        VKQILQHLATKHGINFQEVAFKEEKRCPSCHMTLKDIAHVGKFGCANCYATFKDDIIDIV
    Newman          VKQILQHLATKHGINFQEVAFKEEKRCPSCHMTLKDIAHVGKFGCANCYATFKDDIIDIV
    USA300_FPR3757  VKQILQHLATKHGINFQEVAFKEEKRCPSCHMTLKDIAHVGKFGCANCYATFKDDIIDIV
                    ************************************************************

    COL             RRVQGGQFEHVGKTPHSSHKKIALKRKIEEKNEYLKKLIEIQDFEEAAIVRDEIKALKAE
    N315            RRVQGGQFEHVGKTPHSSHKKIALKRKIEEKNEYLKKLIEIQDFEEAAIVRDEIKALKAE
    NCTC8325        RRVQGGQFEHVGKTPHSSHKKIALKRKIEEKNEYLKKLIEIQDFEEAAIVRDEIKALKAE
    Newman          RRVQGGQFEHVGKTPHSSHKKIALKRKIEEKNEYLKKLIEIQDFEEAAIVRDEIKALKAE
    USA300_FPR3757  RRVQGGQFEHVGKTPHSSHKKIALKRKIEEKNEYLKKLIEIQDFEEAAIVRDEIKALKAE
                    ************************************************************

    COL             SEVQHDDA
    N315            SEVQHDDA
    NCTC8325        SEVQHDDA
    Newman          SEVQHDDA
    USA300_FPR3757  SEVQHDDA
                    ********