From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002290000
  • symbol?: clpC
  • description?: endopeptidase

      descriptions from strain specific annotations:

    • endopeptidase
    • ATPase
    • ClpA-related protein
    • ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative regulator of genetic competence clcC/mecB
    • negative regulator of genetic competence clpC/mecB
    • stress response-related Clp ATPase
    • ATP-dependent Clp protease ATP-binding subunit ClpC
    • pseudogene
    • AAA family ATP-binding protein
    • putative stress response-related Clp ATPase
    • Clp protease ATP binding subunit
  • strand?: +
  • coordinates?: 2810697..2813152
  • synteny block?: BlockID0015890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0570 (clpC)
    N315:
    SA0483 (clpC)
    NCTC8325:
    Newman:
    NWMN_0487 (clpC)
    USA300_FPR3757:
    04-02981:
    SA2981_0500 (clpC)
    08BA02176:
    C248_0597 (clpC)
    11819-97:
    MS7_0514 (clpC)
    71193:
    ST398NM01_0600
    ECT-R 2:
    ECTR2_478
    ED133:
    SAOV_0560
    ED98:
    SAAV_0486
    HO 5096 0412:
    SAEMRSA15_04510 (clpC)
    JH1:
    SaurJH1_0561
    JH9:
    SaurJH9_0547
    JKD6008:
    SAA6008_00531
    JKD6159:
    SAA6159_00478
    LGA251:
    SARLGA251_04600 (clpC)
    M013:
    M013TW_0509
    MRSA252:
    SAR0528 (clpC)
    MSHR1132:
    SAMSHR1132_04690
    MSSA476:
    SAS0482
    Mu3:
    SAHV_0522 (clpC)
    Mu50:
    SAV0525 (clpC)
    MW2:
    MW0480 (clpC)
    RF122:
    SAB0475 (clpC)
    ST398:
    SAPIG0600
    T0131:
    SAT0131_00577
    TCH60:
    HMPREF0772_12666 (clpC)
    TW20:
    SATW20_05940 (clpC)
    USA300_TCH1516:
    USA300HOU_0518
    VC40:
    SAVC_02210

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MLFGRLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGIAAKVLESFNITEDKV
    NCTC8325        MLFGRLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGIAAKVLESFNITEDKV
    Newman          MLFGRLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGIAAKVLESFNITEDKV
    USA300_FPR3757  MLFGRLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGIAAKVLESFNITEDKV
                    ************************************************************

    N315            IEEVEKLIGHGQDHVGTLHYTPRAKKVIELSMDEARKLHHNFVGTEHILLGLIRENEGVA
    NCTC8325        IEEVEKLIGHGQDHVGTLHYTPRAKKVIELSMDEARKLHHNFVGTEHILLGLIRENEGVA
    Newman          IEEVEKLIGHGQDHVGTLHYTPRAKKVIELSMDEARKLHHNFVGTEHILLGLIRENEGVA
    USA300_FPR3757  IEEVEKLIGHGQDHVGTLHYTPRAKKVIELSMDEARKLHHNFVGTEHILLGLIRENEGVA
                    ************************************************************

    N315            ARVFANLDLNITKARAQVVKALGNPEMSNKNAQASKSNNTPTLDSLARDLTVIAKDGTLD
    NCTC8325        ARVFANLDLNITKARAQVVKALGNPEMSNKNAQASKSNNTPTLDSLARDLTVIAKDGTLD
    Newman          ARVFANLDLNITKARAQVVKALGNPEMSNKNAQASKSNNTPTLDSLARDLTVIAKDGTLD
    USA300_FPR3757  ARVFANLDLNITKARAQVVKALGNPEMSNKNAQASKSNNTPTLDSLARDLTVIAKDGTLD
                    ************************************************************

    N315            PVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVNNEVPETLKDKRVM
    NCTC8325        PVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVNNEVPETLKDKRVM
    Newman          PVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVNNEVPETLKDKRVM
    USA300_FPR3757  PVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVNNEVPETLKDKRVM
                    ************************************************************

    N315            SLDMGTVVAGTKYRGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAGGAEGAIDASNIL
    NCTC8325        SLDMGTVVAGTKYRGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAGGAEGAIDASNIL
    Newman          SLDMGTVVAGTKYRGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAGGAEGAIDASNIL
    USA300_FPR3757  SLDMGTVVAGTKYRGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAGGAEGAIDASNIL
                    ************************************************************

    N315            KPALARGELQCIGATTLDEYRKNIEKDAALERRFQPVQVDEPSVVDTVAILKGLRDRYEA
    NCTC8325        KPALARGELQCIGATTLDEYRKNIEKDAALERRFQPVQVDEPSVVDTVAILKGLRDRYEA
    Newman          KPALARGELQCIGATTLDEYRKNIEKDAALERRFQPVQVDEPSVVDTVAILKGLRDRYEA
    USA300_FPR3757  KPALARGELQCIGATTLDEYRKNIEKDAALERRFQPVQVDEPSVVDTVAILKGLRDRYEA
                    ************************************************************

    N315            HHRINISDEAIEAAVKLSNRYVSDRFLPDKAIDLIDEASSKVRLKSHTTPNNLKEIEQEI
    NCTC8325        HHRINISDEAIEAAVKLSNRYVSDRFLPDKAIDLIDEASSKVRLKSHTTPNNLKEIEQEI
    Newman          HHRINISDEAIEAAVKLSNRYVSDRFLPDKAIDLIDEASSKVRLKSHTTPNNLKEIEQEI
    USA300_FPR3757  HHRINISDEAIEAAVKLSNRYVSDRFLPDKAIDLIDEASSKVRLKSHTTPNNLKEIEQEI
                    ************************************************************

    N315            EKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYEEAKNEWKNAQNGMSTSLSEEDIAEVI
    NCTC8325        EKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYEEAKNEWKNAQNGMSTSLSEEDIAEVI
    Newman          EKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYEEAKNEWKNAQNGMSTSLSEEDIAEVI
    USA300_FPR3757  EKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYEEAKNEWKNAQNGMSTSLSEEDIAEVI
                    ************************************************************

    N315            AGWTGIPLTKINETESEKLLSLEDTLHERVIGQKDAVNSISKAVRRARAGLKDPKRPIGS
    NCTC8325        AGWTGIPLTKINETESEKLLSLEDTLHERVIGQKDAVNSISKAVRRARAGLKDPKRPIGS
    Newman          AGWTGIPLTKINETESEKLLSLEDTLHERVIGQKDAVNSISKAVRRARAGLKDPKRPIGS
    USA300_FPR3757  AGWTGIPLTKINETESEKLLSLEDTLHERVIGQKDAVNSISKAVRRARAGLKDPKRPIGS
                    ************************************************************

    N315            FIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSEFMEKHAVSRLVGAPPGYVGHDDGG
    NCTC8325        FIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSEFMEKHAVSRLVGAPPGYVGHDDGG
    Newman          FIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSEFMEKHAVSRLVGAPPGYVGHDDGG
    USA300_FPR3757  FIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSEFMEKHAVSRLVGAPPGYVGHDDGG
                    ************************************************************

    N315            QLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTIIIMTSNV
    NCTC8325        QLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTIIIMTSNV
    Newman          QLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTIIIMTSNV
    USA300_FPR3757  QLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTIIIMTSNV
                    ************************************************************

    N315            GAQELQDQRFAGFGGSSDGQDYETIRKTMLKELKNSFRPEFLNRVDDIIVFHKLTKEELK
    NCTC8325        GAQELQDQRFAGFGGSSDGQDYETIRKTMLKELKNSFRPEFLNRVDDIIVFHKLTKEELK
    Newman          GAQELQDQRFAGFGGSSDGQDYETIRKTMLKELKNSFRPEFLNRVDDIIVFHKLTKEELK
    USA300_FPR3757  GAQELQDQRFAGFGGSSDGQDYETIRKTMLKELKNSFRPEFLNRVDDIIVFHKLTKEELK
                    ************************************************************

    N315            EIVTMMVNKLTNRLSEQNINIIVTDKAKDKIAEEGYDPEYGARPLIRAIQKTIEDNLSEL
    NCTC8325        EIVTMMVNKLTNRLSEQNINIIVTDKAKDKIAEEGYDPEYGARPLIRAIQKTIEDNLSEL
    Newman          EIVTMMVNKLTNRLSEQNINIIVTDKAKDKIAEEGYDPEYGARPLIRAIQKTIEDNLSEL
    USA300_FPR3757  EIVTMMVNKLTNRLSEQNINIIVTDKAKDKIAEEGYDPEYGARPLIRAIQKTIEDNLSEL
                    ************************************************************

    N315            ILDGNQIEGKKVTVDHDGKEFKYDIAEQTSETKTPSQA
    NCTC8325        ILDGNQIEGKKVTVDHDGKEFKYDIAEQTSETKTPSQA
    Newman          ILDGNQIEGKKVTVDHDGKEFKYDIAEQTSETKTPSQA
    USA300_FPR3757  ILDGNQIEGKKVTVDHDGKEFKYDIAEQTSETKTPSQA
                    **************************************