From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002297000
  • symbol?: cysE
  • description?: Serine acetyltransferase-like protein

      descriptions from strain specific annotations:

    • Serine acetyltransferase-like protein
    • serine acetyltransferase
    • serine O-acetyltransferase
    • Serine acetyltransferase homologue
  • strand?: +
  • coordinates?: 2818464..2819233
  • synteny block?: BlockID0015960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0575 (cysE)
    N315:
    SA0487 (cysE)
    NCTC8325:
    Newman:
    NWMN_0491 (cysE)
    USA300_FPR3757:
    04-02981:
    SA2981_0504 (cysE)
    08BA02176:
    C248_0602 (cysE)
    11819-97:
    MS7_0518 (cysE)
    71193:
    ST398NM01_0604
    ECT-R 2:
    ECTR2_482 (cysE)
    ED133:
    SAOV_0564
    ED98:
    SAAV_0490 (cysE)
    HO 5096 0412:
    SAEMRSA15_04550 (cysE)
    JH1:
    SaurJH1_0565
    JH9:
    SaurJH9_0551
    JKD6008:
    SAA6008_00535 (cysE)
    JKD6159:
    SAA6159_00482 (cysE)
    LGA251:
    SARLGA251_04640 (cysE)
    M013:
    M013TW_0513
    MRSA252:
    SAR0532 (cysE)
    MSHR1132:
    SAMSHR1132_04730
    MSSA476:
    SAS0486
    Mu3:
    SAHV_0526 (cysE)
    Mu50:
    SAV0529 (cysE)
    MW2:
    MW0484 (cysE)
    RF122:
    SAB0479 (cysE)
    ST398:
    SAPIG0604 (cysE)
    T0131:
    SAT0131_00581
    TCH60:
    HMPREF0772_12661 (cysE)
    TW20:
    SATW20_05980 (cysE)
    USA300_TCH1516:
    USA300HOU_0522 (cysE)
    VC40:
    SAVC_02230

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQ
    N315            --MLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQ
    NCTC8325        MILLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQ
    Newman          MILLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQ
    USA300_FPR3757  MILLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQ
                      :*********************************************************

    COL             ISRFFTGIEIHPGAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHP
    N315            ISRFFTGIEIHPGAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHP
    NCTC8325        ISRFFTGIEIHPGAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHP
    Newman          ISRFFTGIEIHPGAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHP
    USA300_FPR3757  ISRFFTGIEIHPGAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHP
                    ************************************************************

    COL             DIGDNVLIAAGAKVLGNIKINSNVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVRVGKT
    N315            DIGDNVLIAAGAKVLGNIKINSNVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVRVGKT
    NCTC8325        DIGDNVLIAAGAKVLGNIKINSNVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVRVGKT
    Newman          DIGDNVLIAAGAKVLGNIKINSNVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVRVGKT
    USA300_FPR3757  DIGDNVLIAAGAKVLGNIKINSNVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVRVGKT
                    ************************************************************

    COL             FDHRHLPDPIYEQIKHLERQLEKTRNGEIQDDYII
    N315            FDHRHLPDPIYEQIKHLERQLEKTRNGEIQDDYII
    NCTC8325        FDHRHLPDPIYEQIKHLERQLEKTRNGEIQDDYII
    Newman          FDHRHLPDPIYEQIKHLERQLEKTRNGEIQDDYII
    USA300_FPR3757  FDHRHLPDPIYEQIKHLERQLEKTRNGEIQDDYII
                    ***********************************