Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002302000
  • symbol?: sigH
  • description?: ECF subfamily RNA polymerase sigma-24 factor

      descriptions from strain specific annotations:

    • ECF subfamily RNA polymerase sigma-24 factor
    • igma-70 family RNA polymerase sigma factor
    • putative DNA-binding protein
    • putative RNA polymerase, sigma factor
    • RNA polymerase factor sigma-70
    • RNA polymerase sporulation specific sigmafactor SigH
    • RNA polymerase sigma-H factor
    • putative RNA polymerase sigma factor, sigma-70 family
  • strand?: +
  • coordinates?: 2822374..2822943
  • synteny block?: BlockID0016010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0509
    08BA02176:
    C248_0607 (sigH)
    11819-97:
    MS7_0523
    71193:
    ST398NM01_0609
    ECT-R 2:
    ECTR2_487
    ED133:
    SAOV_0569
    ED98:
    SAAV_0495
    HO 5096 0412:
    SAEMRSA15_04600 (sigH)
    JH1:
    SaurJH1_0570
    JH9:
    SaurJH9_0556
    JKD6008:
    SAA6008_00540
    JKD6159:
    SAA6159_00487
    LGA251:
    SARLGA251_04690 (sigH)
    M013:
    M013TW_0518
    MRSA252:
    SAR0537 (sigH)
    MSHR1132:
    SAMSHR1132_04780
    MSSA476:
    SAS0491
    Mu3:
    SAHV_0531
    Mu50:
    SAV0533
    MW2:
    MW0489
    RF122:
    SAB0484
    ST398:
    SAPIG0609
    T0131:
    SAT0131_00586 (bsaP)
    TCH60:
    HMPREF0772_12656 (sigH)
    TW20:
    SATW20_06030 (sigH)
    USA300_TCH1516:
    USA300HOU_0527
    VC40:
    SAVC_02255

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKYDLTTQDSTIKRNNAINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMY
    N315            MKYDLTTQDSTIKRNNSINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMY
    NCTC8325        MKYDLTTQDSTIKRNNAINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMY
    Newman          MKYDLTTQDSTIKRNNAINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMY
    USA300_FPR3757  MKYDLTTQDSTIKRNNAINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMY
                    ****************:*******************************************

    COL             RSVQTFDFSGEQPFTNYVQCLITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDV
    N315            RSVQTFDFSGEQPFTNYVQCLITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDV
    NCTC8325        RSVQTFDFSGEQPFTNYVQCLITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDV
    Newman          RSVQTFDFSGEQPFTNYVQCLITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDV
    USA300_FPR3757  RSVQTFDFSGEQPFTNYVQCLITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDV
                    ************************************************************

    COL             ENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREIAQLMHVKEKVIYNAIQRCKN
    N315            ENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREIAQLMHVKEKVIYNAIQRCKN
    NCTC8325        ENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREIAQLMHVKEKVIYNAIQRCKN
    Newman          ENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREIAQLMHVKEKVIYNAIQRCKN
    USA300_FPR3757  ENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREIAQLMHVKEKVIYNAIQRCKN
                    ************************************************************

    COL             KIKRYFKMI
    N315            KIKRYFKMI
    NCTC8325        KIKRYFKMI
    Newman          KIKRYFKMI
    USA300_FPR3757  KIKRYFKMI
                    *********