From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002304000
  • symbol?: secE
  • description?: preprotein translocase subunit SecE

      descriptions from strain specific annotations:

    • preprotein translocase subunit SecE
    • preprotein translocase, SecE subunit
  • strand?: +
  • coordinates?: 2823222..2823440
  • synteny block?: BlockID0016030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0581 (secE)
    N315:
    SA0493 (secE)
    NCTC8325:
    Newman:
    NWMN_0497 (secE)
    USA300_FPR3757:
    04-02981:
    SA2981_0511 (secE)
    08BA02176:
    C248_0609 (secE)
    11819-97:
    MS7_0525 (secE)
    71193:
    ST398NM01_0610
    ECT-R 2:
    ECTR2_489 (secE)
    ED133:
    SAOV_0570
    ED98:
    SAAV_0497 (secE)
    HO 5096 0412:
    SAEMRSA15_04620 (secE)
    JH1:
    SaurJH1_0572 (secE)
    JH9:
    SaurJH9_0558 (secE)
    JKD6008:
    SAA6008_00541 (secE)
    JKD6159:
    SAA6159_00488 (secE)
    LGA251:
    SARLGA251_04710 (secE)
    M013:
    M013TW_0520
    MRSA252:
    SAR0539 (secE)
    MSHR1132:
    SAMSHR1132_04790
    MSSA476:
    SAS0493 (secE)
    Mu3:
    SAHV_0532 (secE)
    Mu50:
    SAV0534 (secE)
    MW2:
    MW0490 (secE)
    RF122:
    SAB0486 (secE)
    ST398:
    SAPIG0610 (secE)
    T0131:
    SAT0131_00587 (bsaD)
    TCH60:
    HMPREF0772_12654 (secE)
    TW20:
    SATW20_06050 (secE)
    USA300_TCH1516:
    USA300HOU_0529 (secE)
    VC40:
    SAVC_02265 (secE)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFR
    N315            MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFG
    NCTC8325        MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFG
    Newman          MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFR
    USA300_FPR3757  MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFR
                    ***********************************************************