From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002308000
  • symbol?: rplA
  • description?: 50S ribosomal protein L1

      descriptions from strain specific annotations:

    • 50S ribosomal protein L1
    • 50S ribosomalprotein L1p (L10Ae)
  • strand?: +
  • coordinates?: 2824812..2825501
  • synteny block?: BlockID0016070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0584 (rplA)
    N315:
    SA0496 (rplA)
    NCTC8325:
    Newman:
    NWMN_0500 (rplA)
    USA300_FPR3757:
    04-02981:
    SA2981_0515 (rplA)
    08BA02176:
    C248_0613 (rplA)
    11819-97:
    MS7_0528 (rplA)
    71193:
    ST398NM01_0613
    ECT-R 2:
    ECTR2_492 (rplA)
    ED133:
    SAOV_0573 (rplA)
    ED98:
    SAAV_0500 (rplA)
    HO 5096 0412:
    SAEMRSA15_04650 (rplA)
    JH1:
    SaurJH1_0575 (rplA)
    JH9:
    SaurJH9_0561 (rplA)
    JKD6008:
    SAA6008_00544 (rplA)
    JKD6159:
    SAA6159_00491 (rplA)
    LGA251:
    SARLGA251_04740 (rplA)
    M013:
    M013TW_0523
    MRSA252:
    SAR0543 (rplA)
    MSHR1132:
    SAMSHR1132_04820
    MSSA476:
    SAS0496 (rplA)
    Mu3:
    SAHV_0536 (rplA)
    Mu50:
    SAV0538 (rplA)
    MW2:
    MW0493 (rplA)
    RF122:
    SAB0489 (rplA)
    ST398:
    SAPIG0613 (rplA)
    T0131:
    SAT0131_00590 (bsaA2)
    TCH60:
    HMPREF0772_12651 (rplA)
    TW20:
    SATW20_06080 (rplA)
    USA300_TCH1516:
    USA300HOU_0532 (rplA)
    VC40:
    SAVC_02280 (rplA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKKGKKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVAFRLGIDTRKNDQQIR
    N315            MAKKGKKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVAFRLGIDTRKNDQQIR
    NCTC8325        MAKKGKKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVAFRLGIDTRKNDQQIR
    Newman          MAKKGKKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVAFRLGIDTRKNDQQIR
    USA300_FPR3757  MAKKGKKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVAFRLGIDTRKNDQQIR
                    ************************************************************

    COL             GAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGADYVGEAEYVQKIQQGWFDFDVVVATPDM
    N315            GAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGTDYVGEAEYVQKIQQGWFDFDVVVATPDM
    NCTC8325        GAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGADYVGEAEYVQKIQQGWFDFDVVVATPDM
    Newman          GAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGADYVGEAEYVQKIQQGWFDFDVVVATPDM
    USA300_FPR3757  GAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGADYVGEAEYVQKIQQGWFDFDVVVATPDM
                    *******************************:****************************

    COL             MGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSF
    N315            MGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSF
    NCTC8325        MGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSF
    Newman          MGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSF
    USA300_FPR3757  MGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSF
                    ************************************************************

    COL             TDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKIDTASFK
    N315            TDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKIDTASFK
    NCTC8325        TDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKIDTASFK
    Newman          TDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKIDTASFK
    USA300_FPR3757  TDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKIDTASFK
                    **************************************************