From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002310000
  • symbol?: rplJ
  • description?: 50S ribosomal protein L10

      descriptions from strain specific annotations:

    • 50S ribosomal protein L10
    • 50S ribosomalprotein L10p (P0)
    • ribosomal protein L10 family protein
  • strand?: +
  • coordinates?: 2825776..2826276
  • synteny block?: BlockID0016090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0585 (rplJ)
    N315:
    SA0497 (rplJ)
    NCTC8325:
    Newman:
    NWMN_0501 (rplJ)
    USA300_FPR3757:
    04-02981:
    SA2981_0516 (rplJ)
    08BA02176:
    C248_0614 (rplJ)
    11819-97:
    MS7_0529 (rplJ)
    71193:
    ST398NM01_0614
    ECT-R 2:
    ECTR2_493
    ED133:
    SAOV_0574 (rplJ)
    ED98:
    SAAV_0502 (rplJ)
    HO 5096 0412:
    SAEMRSA15_04660 (rplJ)
    JH1:
    SaurJH1_0576 (rplJ)
    JH9:
    SaurJH9_0562 (rplJ)
    JKD6008:
    SAA6008_00545 (rplJ)
    JKD6159:
    SAA6159_00492 (rplJ)
    LGA251:
    SARLGA251_04750 (rplJ)
    M013:
    M013TW_0524
    MRSA252:
    SAR0544 (rplJ)
    MSHR1132:
    SAMSHR1132_04830
    MSSA476:
    SAS0497 (rplJ)
    Mu3:
    SAHV_0537 (rplJ)
    Mu50:
    SAV0539 (rplJ)
    MW2:
    MW0494 (rplJ)
    RF122:
    SAB0490 (rplJ)
    ST398:
    SAPIG0614
    T0131:
    SAT0131_00592
    TCH60:
    HMPREF0772_12650 (rplJ)
    TW20:
    SATW20_06090 (rplJ)
    USA300_TCH1516:
    USA300HOU_0533 (rplJ)
    VC40:
    SAVC_02285 (rplJ)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSAIIEAKKQLVDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQLREAGVEYKVYKNTMV
    N315            MSAIIEAKKQLVDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQLREAGVEYKVYKNTMV
    NCTC8325        MSAIIEAKKQLVDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQLREAGVEYKVYKNTMV
    Newman          MSAIIEAKKQLVDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQLREAGVEYKVYKNTMV
    USA300_FPR3757  MSAIIEAKKQLVDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQLREAGVEYKVYKNTMV
                    ************************************************************

    COL             RRAAEKAGIEGLDEFLTGPTAIATSSEDAVAAAKVISGFAKDHEALEIKSGVMEGNVITA
    N315            RRAAEKAGIEGLDEFLTGPTAIATSSEDAVAAAKVISGFAKDHEALEIKSGVMEGNVITA
    NCTC8325        RRAAEKAGIEGLDEFLTGPTAIATSSEDAVAAAKVISGFAKDHEALEIKSGVMEGNVITA
    Newman          RRAAEKAGIEGLDEFLTGPTAIATSSEDAVAAAKVISGFAKDHEALEIKSGVMEGNVITA
    USA300_FPR3757  RRAAEKAGIEGLDEFLTGPTAIATSSEDAVAAAKVISGFAKDHEALEIKSGVMEGNVITA
                    ************************************************************

    COL             EEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAVKAIGEQKEENAE
    N315            EEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAVKAIGEQKEENAE
    NCTC8325        EEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAVKAIGEQKEENAE
    Newman          EEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAVKAIGEQKEENAE
    USA300_FPR3757  EEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAVKAIGEQKEENAE
                    **********************************************