From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002321000
  • symbol?:
  • description?: N-acetyl-L,L-diaminopimelate deacetylase

      descriptions from strain specific annotations:

    • N-acetyl-L,L-diaminopimelate deacetylase
    • M20/M25/M40 family peptidase
    • amidohydrolase
    • N-acetyl-L,L-diaminopimelate deacetylase-like protein
    • amidohydrolase family protein
    • Aminoacylase
    • M20D family peptidase
    • M20D subfamily peptidase
    • N-acyl-L-amino acid amidohydrolase
    • putative N-acyl-L-amino acid amidohydrolase
    • putative peptidase
    • thermostable carboxypeptidase 1
  • strand?: -
  • coordinates?: 2840358..2841601
  • synteny block?: BlockID0016200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0526
    08BA02176:
    C248_0624
    11819-97:
    MS7_0539
    71193:
    ST398NM01_0624
    ECT-R 2:
    ECTR2_503
    ED133:
    SAOV_0584c
    ED98:
    SAAV_0512
    HO 5096 0412:
    SAEMRSA15_04760
    JH1:
    SaurJH1_0586
    JH9:
    SaurJH9_0572
    JKD6008:
    SAA6008_00555
    JKD6159:
    SAA6159_00503
    LGA251:
    SARLGA251_04850
    M013:
    M013TW_0536
    MRSA252:
    SAR0554
    MSHR1132:
    SAMSHR1132_04930
    MSSA476:
    SAS0507
    Mu3:
    SAHV_0547
    Mu50:
    SAV0549
    MW2:
    MW0504
    RF122:
    SAB0500c
    ST398:
    SAPIG0624
    T0131:
    SAT0131_00602
    TCH60:
    HMPREF0772_12640
    TW20:
    SATW20_06190
    USA300_TCH1516:
    USA300HOU_0542
    VC40:
    SAVC_02335

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MLDWFQLANNKENKTIQLRRYLHQYPELSFEEFQTHDYIVNQLSQLSCDIETPIGRN
    N315            ---MLDWFQLANNKENKTIQLRRYLHQYPELSFEEFQTHDYIVNQLSQLSCDIETPIGRN
    NCTC8325        ---MLDWFQLANNKENKTIQLRRYLHQYPELSFEEFQTHDYIVNQLSQLSCDIETPIGRN
    Newman          MIRVLDWFQLANNKENKTIQLRRYLHQYPELSFEEFQTHDYIVNQLSQLSCDIETPIGRN
    USA300_FPR3757  ---MLDWFQLANNKENKTIQLRRYLHQYPELSFEEFQTHDYIVNQLSQLSCDIETPIGRN
                       :********************************************************

    COL             GIKATFKGLGTGPTIALRADFDALPVEELNDVPYKSKNPGCMHACGHDGHTAILLTVAEI
    N315            GIKATFKGLGTGPTIALRADFDALPVEELNDVPYKSKNPGCMHACGHDGHTAILLTVAEI
    NCTC8325        GIKATFKGLGTGPTIALRADFDALPVEELNDVPYKSKNPGCMHACGHDGHTAILLTVAEI
    Newman          GIKATFKGLGTGPTIALRADFDALPVEELNDVPYKSKNPGCMHACGHDGHTAILLTVAEI
    USA300_FPR3757  GIKATFKGLGTGPTIALRADFDALPVEELNDVPYKSKNPGCMHACGHDGHTAILLTVAEI
                    ************************************************************

    COL             LDEHKHLLEGNVVLIFQYGEEIMPGGSQEMIDAGCLENVDRIYGTHLWSGYPTGTIHSRA
    N315            LDEHKHLLEGNVVLIFQYGEEIMPGGSQEMIDAGCLENVDRIYGTHLWSGYPTGTIHSRA
    NCTC8325        LDEHKHLLEGNVVLIFQYGEEIMPGGSQEMIDAGCLENVDRIYGTHLWSGYPTGTIHSRA
    Newman          LDEHKHLLEGNVVLIFQYGEEIMPGGSQEMIDAGCLENVDRIYGTHLWSGYPTGTIHSRA
    USA300_FPR3757  LDEHKHLLEGNVVLIFQYGEEIMPGGSQEMIDAGCLENVDRIYGTHLWSGYPTGTIHSRA
                    ************************************************************

    COL             GAIMASPDEFSVTFKGRGGHGAKPHETIDPIVIMAEFILSAQKIISRTIDPVKQAVLSFG
    N315            GAIMASPDEFSVTIKGRGGHGAKPHETIDPIVIMAEFILSAQKIISRTIDPVKQAVLSFG
    NCTC8325        GAIMASPDEFSVTFKGRGGHGAKPHETIDPIVIMAEFILSAQKIISRTIDPVKQAVLSFG
    Newman          GAIMASPDEFSVTFKGRGGHGAKPHETIDPIVIMAEFILSAQKIISRTIDPVKQAVLSFG
    USA300_FPR3757  GAIMASPDEFSVTFKGRGGHGAKPHETIDPIVIMAEFILSAQKIISRTIDPVKQAVLSFG
                    *************:**********************************************

    COL             MIQAGTTDSVIPDQAFCKGTVRTFDSDIQNHVMDKMDKLLQGLAIANDINYDLNYIKGYL
    N315            MIQAGTTDSVIPDQAFCKGTVRTFDSDIQNHVMDKMDKLLQGLAIANDINYDLNYIKGYL
    NCTC8325        MIQAGTTDSVIPDQAFCKGTVRTFDSDIQNHVMDKMDKLLQGLAIANDINYDLNYIKGYL
    Newman          MIQAGTTDSVIPDQAFCKGTVRTFDSDIQNHVMDKMDKLLQGLAIANDINYDLNYIKGYL
    USA300_FPR3757  MIQAGTTDSVIPDQAFCKGTVRTFDSDIQNHVMDKMDKLLQGLAIANDINYDLNYIKGYL
                    ************************************************************

    COL             PVHNNEKAYQVIKEATNDLHVRFNESDLMMIGEDFSHYLKVRPGAFFLTGCGNESKGITA
    N315            PVHNNEKAYQVIKEATNDLHVRFNESDLMMIGEDFSHYLKVRPGAFFLTGCGNESKGITA
    NCTC8325        PVHNNEKAYQVIKEATNDLHVRFNESDLMMIGEDFSHYLKVRPGAFFLTGCGNESKGITA
    Newman          PVHNNEKAYQVIKEATNDLHVRFNESDLMMIGEDFSHYLKVRPGAFFLTGCGNESKGITA
    USA300_FPR3757  PVHNNEKAYQVIKEATNDLHVRFNESDLMMIGEDFSHYLKVRPGAFFLTGCGNESKGITA
                    ************************************************************

    COL             PHHNPKFDIDEKSLKYAVAVFLKIIELEQVFKTN
    N315            PHHNPKFDIDEKSLKYAVAVFLKIIELEQVFKTN
    NCTC8325        PHHNPKFDIDEKSLKYAVAVFLKIIELEQVFKTN
    Newman          PHHNPKFDIDEKSLKYAVAVFLKIIELEQVFKTN
    USA300_FPR3757  PHHNPKFDIDEKSLKYAVAVFLKIIELEQVFKTN
                    **********************************