From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002331000
  • symbol?: tadA
  • description?: cytosine deaminase

      descriptions from strain specific annotations:

    • cytosine deaminase
    • pseudogene
    • putative deaminase
    • zinc-binding CMP/dCMP deaminase
    • putative tRNA-specific adenosine deaminase
    • tRNA-specific adenosine-34 deaminase
    • cytidine and deoxycytidylate deaminase zinc-binding region family protein
    • tRNA-adenosine deaminase
  • strand?: +
  • coordinates?: 2851013..2851483
  • synteny block?: BlockID0016300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0535
    08BA02176:
    C248_0633
    11819-97:
    MS7_0548 (tadA)
    71193:
    ST398NM01_0633
    ECT-R 2:
    ECTR2_512
    ED133:
    SAOV_0593
    ED98:
    SAAV_0521
    HO 5096 0412:
    SAEMRSA15_04850
    JH1:
    SaurJH1_0595
    JH9:
    SaurJH9_0581
    JKD6008:
    SAA6008_00565
    JKD6159:
    SAA6159_00512
    LGA251:
    SARLGA251_04940
    M013:
    M013TW_0545
    MRSA252:
    SAR0563
    MSHR1132:
    SAMSHR1132_05020
    MSSA476:
    SAS0516
    Mu3:
    SAHV_0556
    Mu50:
    SAV0558
    MW2:
    MW0513
    RF122:
    SAB0509
    ST398:
    SAPIG0633
    T0131:
    SAT0131_00612
    TCH60:
    HMPREF0772_12631 (tadA)
    TW20:
    SATW20_06280
    USA300_TCH1516:
    USA300HOU_0552
    VC40:
    SAVC_02385

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAEHIAIE
    NCTC8325        MTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAEHIAIE
    Newman          MTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAEHIAIE
    USA300_FPR3757  MTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAEHIAIE
                    ************************************************************

    N315            RAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQS
    NCTC8325        RAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQS
    Newman          RAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQS
    USA300_FPR3757  RAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQS
                    ************************************************************

    N315            NFNHRAIVDKGVLKEACSTLLTTFFKNLRANKKSTN
    NCTC8325        NFNHRAIVDKGVLKEACSTLLTTFFKNLRANKKSTN
    Newman          NFNHRAIVDKGVLKEACSTLLTTFFKNLRANKKSTN
    USA300_FPR3757  NFNHRAIVDKGVLKEACSTLLTTFFKNLRANKKSTN
                    ************************************