From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002345000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 2885247..2885606
  • synteny block?: BlockID0016440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0545
    08BA02176:
    C248_0643
    11819-97:
    MS7_0558
    71193:
    ST398NM01_0643
    ECT-R 2:
    ECTR2_522
    ED133:
    SAOV_0603c
    ED98:
    SAAV_0531
    HO 5096 0412:
    SAEMRSA15_04950
    JH1:
    SaurJH1_0605
    JH9:
    SaurJH9_0591
    JKD6008:
    SAA6008_00576
    JKD6159:
    SAA6159_00522
    LGA251:
    SARLGA251_05040
    M013:
    M013TW_0556
    MRSA252:
    SAR0572
    MSHR1132:
    SAMSHR1132_05120
    MSSA476:
    SAS0526
    Mu3:
    SAHV_0566
    Mu50:
    SAV0568
    MW2:
    MW0523
    RF122:
    SAB0518c
    ST398:
    SAPIG0643
    T0131:
    SAT0131_00629
    TCH60:
    HMPREF0772_12620
    TW20:
    SATW20_06380
    USA300_TCH1516:
    USA300HOU_0562
    VC40:
    SAVC_02430

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MLEPIKEQEVIDLLASFEHKPVYLHVETTNGAYANHFDQRVFNAGTFLRNIQITYTHA
    N315            ---MEPIKEQEVIDLLASFEHKPVYLHVETTNGAYANHFDQRVFNAGTFLRNIQVTYTHA
    NCTC8325        --MLEPIKEQEVIDLLASFEHKPVYLHVETTNGAYANHFDQRVFNAGTFLRNIQITYTHA
    Newman          MNVLEPIKEQEVIDLLASFEHKPVYLHVETTNGAYANHFDQRVFNAGTFLRNIQITYTHA
    USA300_FPR3757  --MLEPIKEQEVIDLLASFEHKPVYLHVETTNGAYANHFDQRVFNAGTFLRNIQITYTHA
                       :**************************************************:*****

    COL             QLKGGNKEPYRIGLKLSNGGWVYVQGLTHFEVNEHDEFLIAGFNYEGQLAAALQISERPF
    N315            QLKGGNKEPYRIGLKLSNGGWVYVQGLTHFEVNEHDEFLIAGFNYEGQLAAALQISERPF
    NCTC8325        QLKGGNKEPYRIGLKLSNGGWVYVQGLTHFEVNEHDEFLIAGFNYEGQLAAALQISERPF
    Newman          QLKGGNKEPYRIGLKLSNGGWVYVQGLTHFEVNEHDEFLIAGFNYEGQLAAALQISERPF
    USA300_FPR3757  QLKGGNKEPYRIGLKLSNGGWVYVQGLTHFEVNEHDEFLIAGFNYEGQLAAALQISERPF
                    ************************************************************

    COL             NL
    N315            NL
    NCTC8325        NL
    Newman          NL
    USA300_FPR3757  NL
                    **