From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002349000
  • symbol?:
  • description?: HAD family hydrolase

      descriptions from strain specific annotations:

    • HAD family hydrolase
    • HAD superfamily hydrolase
    • haloacid dehalogenase-like hydrolase
    • Phosphoglycolate phosphatase
    • HAD hydrolase family protein
    • haloacid dehalogenase
    • indigoidine synthesis protein
    • indigoidine systhesis protein
    • putative haloacid dehalogenase-like hydrolase
    • putative hydrolase, haloacid dehalogenase-like protein
  • strand?: +
  • coordinates?: 2888014..2888670
  • synteny block?: BlockID0016480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0549
    08BA02176:
    C248_0647
    11819-97:
    MS7_0562
    71193:
    ST398NM01_0647
    ECT-R 2:
    ECTR2_526
    ED133:
    SAOV_0607
    ED98:
    SAAV_0535
    HO 5096 0412:
    SAEMRSA15_04990
    JH1:
    SaurJH1_0609
    JH9:
    SaurJH9_0595
    JKD6008:
    SAA6008_00580
    JKD6159:
    SAA6159_00526
    LGA251:
    SARLGA251_05080
    M013:
    M013TW_0560
    MRSA252:
    SAR0576
    MSHR1132:
    SAMSHR1132_05160
    MSSA476:
    SAS0530
    Mu3:
    SAHV_0570
    Mu50:
    SAV0572
    MW2:
    MW0527
    RF122:
    SAB0522
    ST398:
    SAPIG0647
    T0131:
    SAT0131_00633
    TCH60:
    HMPREF0772_12616
    TW20:
    SATW20_06420
    USA300_TCH1516:
    USA300HOU_0566
    VC40:
    SAVC_02450

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLILKFDNYIFDFDGTLADTKKCGEVATQSAFKACGLTEPSSKEITHYMGIPIEESFLKL
    N315            ---MKFDNYIFDFDGTLADTKKCGEVATQSAFKACGLTEPSSKEITHYMGIPIEESFLKL
    NCTC8325        ---MKFDNYIFDFDGTLADTKKCGEVATQSAFKACGLTEPSSKEITHYMGIPIEESFLKL
    Newman          MLILKFDNYIFDFDGTLADTKKCGEVATQSAFKACGLTEPSSKEITHYMGIPIEESFLKL
    USA300_FPR3757  ---MKFDNYIFDFDGTLADTKKCGEVATQSAFKACGLTEPSSKEITHYMGIPIEESFLKL
                       :********************************************************

    COL             ADRPLDEAALAKLIDTFRHTYQSIEKDYIYEFAGITEAITSLYNQGKKLFVVSSKKSDVL
    N315            ADRPLDEAALAKLIDTFRHTYQSIEKDYIYEFAGITEAITSLYNQGKKLFVVSSKKSDVL
    NCTC8325        ADRPLDEAALAKLIDTFRHTYQSIEKDYIYEFAGITEAITSLYNQGKKLFVVSSKKSDVL
    Newman          ADRPLDEAALAKLIDTFRHTYQSIEKDYIYEFAGITEAITSLYNQGKKLFVVSSKKSDVL
    USA300_FPR3757  ADRPLDEAALAKLIDTFRHTYQSIEKDYIYEFAGITEAITSLYNQGKKLFVVSSKKSDVL
                    ************************************************************

    COL             ERNLSAIGLNHLITEAVGSDQVSAYKPNPEGIHTIVQRYNLNSQQTVYIGDSTFDVEMAQ
    N315            ERNLSAIGLNHLITEAVGSDQVSAYKPNPEGIHTIVQRYNLNSQQTVYIGDSTFDVEMAQ
    NCTC8325        ERNLSAIGLNHLITEAVGSDQVSAYKPNPEGIHTIVQRYNLNSQQTVYIGDSTFDVEMAQ
    Newman          ERNLSAIGLNHLITEAVGSDQVSAYKPNPEGIHTIVQRYNLNSQQTVYIGDSTFDVEMAQ
    USA300_FPR3757  ERNLSAIGLNHLITEAVGSDQVSAYKPNPEGIHTIVQRYNLNSQQTVYIGDSTFDVEMAQ
                    ************************************************************

    COL             RAGMQSAAVTWGAHDARSLLHSNPDFIINDPSEINTVL
    N315            HAGVPSAAVTWGAHDARSLLHSNPDFIINDPSEINTVL
    NCTC8325        RAGMQSAAVTWGAHDARSLLHSNPDFIINDPSEINTVL
    Newman          RAGMQSAAVTWGAHDARSLLHSNPDFIINDPSEINTVL
    USA300_FPR3757  RAGMQSAAVTWGAHDARSLLHSNPDFIINDPSEINTVL
                    :**: *********************************