From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002352000
  • symbol?: vraA
  • description?: substrate--CoA ligase

      descriptions from strain specific annotations:

    • substrate--CoA ligase
    • AMP-binding protein
    • putative substrate--CoA ligase
    • AMP-dependent synthetase and ligase
    • long chain fatty acid CoA ligase vraA
    • long-chain-fatty-acid--CoA ligase
    • substrate--CoA ligase, putative
    • long chain fatty acid CoA ligase, VraA
    • putative long chain fatty acid CoA ligase VraA (Acyl-CoAsynthetase)
    • Putative long chain fatty acid-CoA ligase vraA
  • strand?: +
  • coordinates?: 2891552..2893009
  • synteny block?: BlockID0016510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0533 (vraA)
    NCTC8325:
    Newman:
    NWMN_0538 (vraA)
    USA300_FPR3757:
    04-02981:
    SA2981_0552 (vraA)
    08BA02176:
    C248_0650
    11819-97:
    MS7_0564
    71193:
    ST398NM01_0649
    ECT-R 2:
    ECTR2_528
    ED133:
    SAOV_0609
    ED98:
    SAAV_0537
    HO 5096 0412:
    SAEMRSA15_05020
    JH1:
    SaurJH1_0612
    JH9:
    SaurJH9_0598
    JKD6008:
    SAA6008_00582 (vraA)
    JKD6159:
    SAA6159_00528 (vraA)
    LGA251:
    SARLGA251_05100
    M013:
    M013TW_0562
    MRSA252:
    SAR0580
    MSHR1132:
    SAMSHR1132_05180
    MSSA476:
    SAS0533
    Mu3:
    SAHV_0573 (vraA)
    Mu50:
    SAV0575 (vraA)
    MW2:
    MW0530 (vraA)
    RF122:
    SAB0525
    ST398:
    SAPIG0649
    T0131:
    SAT0131_00635
    TCH60:
    HMPREF0772_12614
    TW20:
    SATW20_06440
    USA300_TCH1516:
    USA300HOU_0568 (vraA)
    VC40:
    SAVC_02460

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNVILEQLKTHTQNKPNDIALHIDDETITYSQLNARITSAVESLQKYSLNPVVAINMKSP
    N315            MNVILEQLKTHTQNKPNDIALHIDDETITYSQLNARITSAVESLQKYSLNPVVAINMKSP
    NCTC8325        MNVILEQLKTHTQNKPNDIALHIDDETITYSQLNARITSAVESLQKYSLNPVVAINMKSP
    Newman          MNVILEQLKTHTQNKPNDIALHIDDETITYSQLNARITSAVESLQKYSLNPVVAINMKSP
    USA300_FPR3757  MNVILEQLKTHTQNKPNDIALHIDDETITYSQLNARITSAVESLQKYSLNPVVAINMKSP
                    ************************************************************

    COL             VQSIICYLALHRLHKVPMMMEGKWQSTIHRQLIEKYGIKDVIGDTGLMQNIDSPMFIDST
    N315            VQSIICYLALHRLHKVPMMMEGKWQSTIHRQLIEKYGIKDVIGDTGLMQNIDSPMFIDST
    NCTC8325        VQSIICYLALHRLHKVPMMMEGKWQSTIHRQLIEKYGIKDVIGDTGLMQNIDSPMFIDST
    Newman          VQSIICYLALHRLHKVPMMMEGKWQSTIHRQLIEKYGIKDVIGDTGLMQNIDSPMFIDST
    USA300_FPR3757  VQSIICYLALHRLHKVPMMMEGKWQSTIHRQLIEKYGIKDVIGDTGLMQNIDSPMFIDST
                    ************************************************************

    COL             QLQHYPNLLHIGFTSGTTGLPKAYYRDEDSWLASFEVNEMLMLKNENAIAAPGPLSHSLT
    N315            QLQHYPNLLHIGFTSGTTGLPKAYYRDEDSWLASFEVNEMLMLKNENAIAAPGPLSHSLT
    NCTC8325        QLQHYPNLLHIGFTSGTTGLPKAYYRDEDSWLASFEVNEMLMLKNENAIAAPGPLSHSLT
    Newman          QLQHYPNLLHIGFTSGTTGLPKAYYRDEDSWLASFEVNEMLMLKNENAIAAPGPLSHSLT
    USA300_FPR3757  QLQHYPNLLHIGFTSGTTGLPKAYYRDEDSWLASFEVNEMLMLKNENAIAAPGPLSHSLT
                    ************************************************************

    COL             LYALLFALSSGRTFIGQTTFHPEKLLNQCHKISSYKVAMFLVPTMIKSLLLVYNNEHTIQ
    N315            LYALLFALSSGRTFIGQTTFHPEKLLNQCHKISSYKVAMFLVPTMIKSLLLVYNNEHTIQ
    NCTC8325        LYALLFALSSGRTFIGQTTFHPEKLLNQCHKISSYKVAMFLVPTMIKSLLLVYNNEHTIQ
    Newman          LYALLFALSSGRTFIGQTTFHPEKLLNQCHKISSYKVAMFLVPTMIKSLLLVYNNEHTIQ
    USA300_FPR3757  LYALLFALSSGRTFIGQTTFHPEKLLNQCHKISSYKVAMFLVPTMIKSLLLVYNNEHTIQ
                    ************************************************************

    COL             SFFSSGDKLHSSIFKKIKNQANDINLIEFFGTSETSFISYNLNQQAPVESVGVLFPNVEL
    N315            SFFSSGDKLHSSIFKKIKNQANDINLIEFFGTSETSFISYNLNQQAPVESVGVLFPNVEL
    NCTC8325        SFFSSGDKLHSSIFKKIKNQANDINLIEFFGTSETSFISYNLNQQAPVESVGVLFPNVEL
    Newman          SFFSSGDKLHSSIFKKIKNQANDINLIEFFGTSETSFISYNLNQQAPVESVGVLFPNVEL
    USA300_FPR3757  SFFSSGDKLHSSIFKKIKNQANDINLIEFFGTSETSFISYNLNQQAPVESVGVLFPNVEL
                    ************************************************************

    COL             KTTNHDHNGIGTICIKSNMMFSGYVSEQCINNDEWFVTNDNGYVKEQYLYLTGRQQDMLI
    N315            KTTNHDHNGIGTICIKSNMMFSGYVSEQCINNDEWFVTNDNGYVKEQYLYLTGRQQDMLI
    NCTC8325        KTTNHDHNGIGTICIKSNMMFSGYVSEQCINNDEWFVTNDNGYVKEQYLYLTGRQQDMLI
    Newman          KTTNHDHNGIGTICIKSNMMFSGYVSEQCINNDEWFVTNDNGYVKEQYLYLTGRQQDMLI
    USA300_FPR3757  KTTNHDHNGIGTICIKSNMMFSGYVSEQCINNDEWFVTNDNGYVKEQYLYLTGRQQDMLI
                    ************************************************************

    COL             IGGQNIYPAHVERLLTQSSSIDEAIIIGIPNERFGQIGVLLYSGDVTLTHKNVKQFLKKK
    N315            IGGQNIYPAHVERLLTQSSSIDEAIIIGIPNERFGQIGVLLYSGDVTLTHKNVKQFLKKK
    NCTC8325        IGGQNIYPAHVERLLTQSSSIDEAIIIGIPNERFGQIGVLLYSGDVTLTHKNVKQFLKKK
    Newman          IGGQNIYPAHVERLLTQSSSIDEAIIIGIPNERFGQIGVLLYSGDVTLTHKNVKQFLKKK
    USA300_FPR3757  IGGQNIYPAHVERLLTQSSSIDEAIIIGIPNERFGQIGVLLYSGDVTLTHKNVKQFLKKK
                    ************************************************************

    COL             VKRYEIPSMIHHVEKMYYTASGKIAREKMMSMYLRGEL
    N315            VKRYEIPSMIHHVEKMYYTASGKIAREKMMSMYLRGEL
    NCTC8325        VKRYEIPSMIHHVEKMYYTASGKIAREKMMSMYLRGEL
    Newman          VKRYEIPSMIHHVEKMYYTASGKIAREKMMSMYLRGEL
    USA300_FPR3757  VKRYEIPSMIHHVEKMYYTASGKIAREKMMSMYLRGEL
                    **************************************