From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002356000
  • symbol?: vraX
  • description?: protein vraX
  • strand?: -
  • coordinates?: 2894965..2895132
  • synteny block?: BlockID0016550
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0556
    08BA02176:
    C248_0654
    11819-97:
    MS7_0568 (vraX)
    71193:
    ST398NM01_0653
    ECT-R 2:
    ECTR2_532
    ED133:
    SAOV_0613c
    ED98:
    SAAV_0541
    HO 5096 0412:
    SAEMRSA15_05060
    JH1:
    SaurJH1_0616
    JH9:
    SaurJH9_0602
    JKD6008:
    SAA6008_00586
    JKD6159:
    SAA6159_00532
    LGA251:
    SARLGA251_05140
    M013:
    M013TW_0566
    MRSA252:
    SAR0584
    MSHR1132:
    SAMSHR1132_05220
    MSSA476:
    SAS0537
    Mu3:
    SAHV_0577
    Mu50:
    SAV0579
    MW2:
    MW0534
    RF122:
    SAB0529c
    ST398:
    SAPIG0653
    T0131:
    SAT0131_00639 (acpD)
    TCH60:
    HMPREF0772_12610
    TW20:
    SATW20_06480
    USA300_TCH1516:
    USA300HOU_0572
    VC40:
    SAVC_02480

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIIYRQYHHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLLQDDIDHMKVS
    N315            MIIYRQYHHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLLQDDIDHMKVS
    NCTC8325        MIIYRQYHHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLLQDDIDHMKVS
    Newman          MIIYRQYHHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLLQDDIDHMKVS
                    *******************************************************