From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002357000
  • symbol?: pdxK
  • description?: phosphomethylpyrimidine kinase

      descriptions from strain specific annotations:

    • phosphomethylpyrimidine kinase
    • phosphomethylpyrimidine kinase (HMP-phosphate kinase)(HMP-P kinase)
    • Putative pyridoxine kinase
    • hydroxymethylpyrimidine kinase
  • strand?: -
  • coordinates?: 2895924..2896754
  • synteny block?: BlockID0016560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0626 (thiD1)
    N315:
    NCTC8325:
    Newman:
    NWMN_0543 (thiD)
    USA300_FPR3757:
    04-02981:
    SA2981_0557
    08BA02176:
    C248_0655
    11819-97:
    MS7_0569 (pdxK)
    71193:
    ST398NM01_0654
    ECT-R 2:
    ECTR2_533 (thiD)
    ED133:
    SAOV_0614c (thiD1)
    ED98:
    SAAV_0542 (thiD1)
    HO 5096 0412:
    SAEMRSA15_05070
    JH1:
    SaurJH1_0617
    JH9:
    SaurJH9_0603
    JKD6008:
    SAA6008_00587 (thiD1)
    JKD6159:
    SAA6159_00533 (thiD1)
    LGA251:
    SARLGA251_05150 (thiD)
    M013:
    M013TW_0567
    MRSA252:
    SAR0585
    MSHR1132:
    SAMSHR1132_05230
    MSSA476:
    SAS0538
    Mu3:
    SAHV_0578
    Mu50:
    SAV0580
    MW2:
    MW0535
    RF122:
    SAB0530c
    ST398:
    SAPIG0654 (thiD)
    T0131:
    SAT0131_00640
    TCH60:
    HMPREF0772_12609 (thiD2)
    TW20:
    SATW20_06490 (thiD)
    USA300_TCH1516:
    USA300HOU_0573 (thiD)
    VC40:
    SAVC_02485

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MALKKVLTIAGSDTSAGAGMQADLKTFQELDTYGMVALTAIVTMDKDTWSHDVTPLPMDV
    N315            MALKKVLTIAGSDTSAGAGMQADLKTFQELDTYGMVALTAIVTMDKDTWSHDVTPLPMDV
    NCTC8325        MALKKVLTIAGSDTSAGAGMQADLKTFQELDTYGMVALTAIVTMDKDTWSHDVTPLPMDV
    Newman          MALKKVLTIAGSDTSAGAGMQADLKTFQELDTYGMVALTAIVTMDKDTWSHDVTPLPMDV
    USA300_FPR3757  MALKKVLTIAGSDTSAGAGMQADLKTFQELDTYGMVALTAIVTMDKDTWSHDVTPLPMDV
                    ************************************************************

    COL             FEKQLETALSIGPDAIKTGMLGTEEIIKRAGEVYEASNAQYFVVDPVMVCKGEDEVLNPG
    N315            FEKQLETALSIGPDAIKTGMLGTEEIIKRAGEVYEASNAQYFVVDPVMVCKGEDEVLNPG
    NCTC8325        FEKQLETALSIGPDAIKTGMLGTEEIIKRAGEVYEASNAQYFVVDPVMVCKGEDEVLNPG
    Newman          FEKQLETALSIGPDAIKTGMLGTEEIIKRAGEVYEASNAQYFVVDPVMVCKGEDEVLNPG
    USA300_FPR3757  FEKQLETALSIGPDAIKTGMLGTEEIIKRAGEVYEASNAQYFVVDPVMVCKGEDEVLNPG
                    ************************************************************

    COL             NTEAMIKYLLPKATVVTPNLFEAGQLSGLGKLNSIEDMKKAATIIFDKGAQHVIIKGGKA
    N315            NTEAMIKYLLPKATVVTPNLFEAGQLSGLGKLNSIEDMKKAATIIFDKGAQHVIIKGGKA
    NCTC8325        NTEAMIKYLLPKATVVTPNLFEAGQLSGLGKLNSIEDMKKAATIIFDKGAQHVIIKGGKA
    Newman          NTEAMIKYLLPKATVVAPNLFEAGQLSGLGKLNSIEDMKKAATIIFDKGAQHVIIKGGKA
    USA300_FPR3757  NTEAMIKYLLPKATVVTPNLFEAGQLSGLGKLNSIEDMKKAATIIFDKGAQHVIIKGGKA
                    ****************:*******************************************

    COL             LDQDKSYDLYYDGQTFYQLTTDMFQQSYNHGAGCTFAAATTAYLANGKSPKEAVISAKAF
    N315            LDQDKSYDLYYDGQTFYQLTTDMFQQSYNHGAGCTFAAATTAYLANGKSPKEAVISAKAF
    NCTC8325        LDQDKSYDLYYDGQTFYQLTTDMFQQSYNHGAGCTFAAATTAYLANGKSPKEAVISAKAF
    Newman          LDQDKSYDLYYDGQTFYQLTTDMFQQSYNHGAGCTFAAATTAYLANGKSPKEAVISAKAF
    USA300_FPR3757  LDQDKSYDLYYDGQTFYQLTTDMFQQSYNHGAGCTFAAATTAYLANGKSPKEAVISAKAF
                    ************************************************************

    COL             VASAIKNGWKMNDFVGPVDHGAYNRIEHIDVEVTEV
    N315            VASAIKNGWKMNDFVGPVDHGAYNRIEHIDVEVTEV
    NCTC8325        VASAIKNGWKMNDFVGPVDHGAYNRIEHIDVEVTEV
    Newman          VASAIKNGWKMNDFVGPVDHGAYNRIEHIDVEVTEV
    USA300_FPR3757  VASAIKNGWKMNDFVGPVDHGAYNRIEHIDVEVTEV
                    ************************************