From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002361000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • membrane spanning protein
  • strand?: +
  • coordinates?: 2900000..2900368
  • synteny block?: BlockID0016600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0560
    08BA02176:
    C248_0658
    11819-97:
    MS7_0572
    71193:
    ST398NM01_0657
    ECT-R 2:
    ECTR2_536
    ED133:
    SAOV_0617
    ED98:
    SAAV_0545
    HO 5096 0412:
    SAEMRSA15_05100
    JH1:
    SaurJH1_0620
    JH9:
    SaurJH9_0606
    JKD6008:
    SAA6008_00590
    JKD6159:
    SAA6159_00536
    LGA251:
    SARLGA251_05180
    M013:
    M013TW_0570
    MRSA252:
    SAR0588
    MSHR1132:
    SAMSHR1132_05270
    MSSA476:
    SAS0541
    Mu3:
    SAHV_0581
    Mu50:
    SAV0583
    MW2:
    MW0538
    RF122:
    SAB0533
    ST398:
    SAPIG0657
    T0131:
    SAT0131_00644
    TCH60:
    HMPREF0772_12606
    TW20:
    SATW20_06520
    USA300_TCH1516:
    USA300HOU_0576
    VC40:
    SAVC_02500

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG
    N315            MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG
    NCTC8325        MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG
    Newman          MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG
    USA300_FPR3757  MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG
                    ************************************************************

    COL             TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKF
    N315            TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKF
    NCTC8325        TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKF
    Newman          TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKF
    USA300_FPR3757  TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKF
                    ************************************************************

    COL             AG
    N315            AG
    NCTC8325        AG
    Newman          AG
    USA300_FPR3757  AG
                    **