From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002452000
  • symbol?:
  • description?: pseudogene

      descriptions from strain specific annotations:

    • pseudogene
    • repetative hypothetical protein
    • staphylococcus aureus paralogous family
  • strand?: +
  • coordinates?: 2963370..2964329
  • synteny block?: BlockID0016890
  • occurrence?: in 63% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0576
    08BA02176:
    C248_0675
    11819-97:
    MS7_0652
    71193:
    ECT-R 2:
    ECTR2_552
    ED133:
    SAOV_0634
    ED98:
    SAAV_0563
    HO 5096 0412:
    SAEMRSA15_05260
    JH1:
    SaurJH1_0637
    JH9:
    SaurJH9_0622
    JKD6008:
    JKD6159:
    SAA6159_00555
    LGA251:
    SARLGA251_05350
    M013:
    MRSA252:
    SAR0607
    MSHR1132:
    SAMSHR1132_05420
    MSSA476:
    Mu3:
    SAHV_0597
    Mu50:
    SAV0599
    MW2:
    RF122:
    SAB0550
    ST398:
    SAPIG0672
    T0131:
    TCH60:
    HMPREF0772_12587
    TW20:
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            ---MVCEVIAIYKNPKYRIIKYNDEYLMVNIINNWLVLFIPLLNWLTPKRYIKISQEELE
    Newman          METLLCETENINKNPKYRIIKYKDEYLMIDLVSIWLALFFPMINWLIPKKYVKISEKDFE
                       ::**.  * **********:*****::::. **.**:*::*** **:*:***::::*

    N315            SLNTFKPAKNNAFWPALGSSVLFSVTFRKYMPLFNVRLEKTIVIAIFFVVFLGI-LFFYL
    Newman          TLNIVKTAKINSFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVILICCIIILGIFLFFYI
                    :** .*.** *:***. **:***.* :*:*  ** *: * :*** *  :::*** ****:

    N315            NLNRRLALSVFTMNKEKSQKMILLPNLKHFFFIIFAYLYFGGFSFFTLYALITIDVQNII
    Newman          ------------------------------------------------------------
                                                                                

    N315            IFICWGAVTMFFFFINIVPIGIKKAHVILLKKAE
    Newman          ----------------------------------