From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002463000
  • symbol?: iolS
  • description?: aldo/keto reductase

      descriptions from strain specific annotations:

    • aldo/keto reductase
    • aldo/keto reductase family protein
    • aldo/keto reductase oxidoreductase
    • aldo/keto reductase family oxidoreductase
    • dehydrogenase
    • Iols
    • oxidoreducatse ion channel
    • oxidoreductase, aldo/keto reductase family
    • Oxidoreductase ion channel
    • protein IolS
    • protein iolS (Vegetative protein 147) (VEG147) (AKR11A)
    • pseudogene
  • strand?: +
  • coordinates?: 2980559..2981497
  • synteny block?: BlockID0017000
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0577
    08BA02176:
    C248_0684
    11819-97:
    MS7_0653 (iolS)
    71193:
    ST398NM01_0681
    ECT-R 2:
    ECTR2_553
    ED133:
    SAOV_0635
    ED98:
    SAAV_0564
    HO 5096 0412:
    SAEMRSA15_05270
    JH1:
    SaurJH1_0638
    JH9:
    SaurJH9_0623
    JKD6008:
    SAA6008_00618
    JKD6159:
    SAA6159_00556
    LGA251:
    SARLGA251_05360
    M013:
    M013TW_0589
    MRSA252:
    SAR0608
    MSHR1132:
    SAMSHR1132_05430
    MSSA476:
    SAS0568
    Mu3:
    SAHV_0598
    Mu50:
    SAV0600
    MW2:
    MW0563
    RF122:
    SAB0552
    ST398:
    SAPIG0681
    T0131:
    SAT0131_00667
    TCH60:
    HMPREF0772_12586
    TW20:
    SATW20_06770
    USA300_TCH1516:
    USA300HOU_0606
    VC40:
    SAVC_02640

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQFVNLGKSDVEVFPIALGTNAVGGHNLYPNLDEEQGKDVVRQAINHGINLLDTAYIYG
    N315            MKQFVNLGKSDVEVFPIALGTNAVGGHNLYPNLDEEQGKDVVRQAINHGINLLDTAYIYG
    NCTC8325        MKQFVNLGKSDVEVFPIALGTNAVGGHNLYPNLDEEQGKDVVRQAINHGINLLDTAYIYG
    Newman          MKQFVNLGKSDVEVFPIALGTNAVGGHNLYPNLDEEQGKDVVRQAINHGINLLDTAYIYG
    USA300_FPR3757  MKQFVNLGKSDVEVFPIALGTNAVGGHNLYPNLDEEQGKDVVRQAINHGINLLDTAYIYG
                    ************************************************************

    COL             PERSEELVGEVVKEYPREQIKIATKGSHEFDENQEVHQNNQPEYLKQQVENSLKRLQTDY
    N315            PERSEELVGEVVKEYPREQIKIATKGSHEFDENQEVHQNNQPEYLKQQVENSLKRLQTDY
    NCTC8325        PERSEELVGEVVKEYPREQIKIATKGSHEFDENQEVHQNNQPEYLKQQVENSLKRLQTDY
    Newman          PERSEELVGEVVKEYPREQIKIATKGSHEFDENQEVHQNNQPEYLKQQVENSLKRLQTDY
    USA300_FPR3757  PERSEELVGEVVKEYPREQIKIATKGSHEFDENQEVHQNNQPEYLKQQVENSLKRLQTDY
                    ************************************************************

    COL             IDLYYIHFPDNNTPKDQAVAALQELKEQGKIKAIGVSNFTLDQLKEANKDGYVDVVQLEY
    N315            IDLYYIHFPDDNTPKDQAVAALQELKEQGKIKAIGVSNFTLDQLKEANKDGYVDVVQLEY
    NCTC8325        IDLYYIHFPDNNTPKDQAVAALQELKEQGKIKAIGVSNFTLDQLKEANKDGYVDVVQLEY
    Newman          IDLYYIHFPDNNTPKDQAVAALQELKEQGKIKAIGVSNFTLDQLKEANKDGYVDVVQLEY
    USA300_FPR3757  IDLYYIHFPDNNTPKDQAVAALQELKEQGKIKAIGVSNFTLDQLKEANKDGYVDVVQLEY
                    **********:*************************************************

    COL             NLLHRENEAVLQYCVDHQITFIPYFPLASGILAGKYDENTKFSDHRTTRRDFKPGVFEEN
    N315            NLLHRENEAVLQYCVDHLITFIPYFPLASGILAGKYDENTKFSDHRTTRRDFIPGVFEEN
    NCTC8325        NLLHRENEAVLQYCVDHQITFIPYFPLASGILAGKYDENTKFSDHRTTRRDFKPGVFEEN
    Newman          NLLHRENEAVLQYCVDHQITFIPYFPLASGILAGKYDENTKFSDHRTTRRDFKPGVFEEN
    USA300_FPR3757  NLLHRENEAVLQYCVDHQITFIPYFPLASGILAGKYDENTKFSDHRTTRRDFKPGVFEEN
                    ***************** ********************************** *******

    COL             VRRVKALESIAAAHQTSIANIVLAFYLTRPAIDVIIPGAKRAEQVVENIKAADIVLSDDE
    N315            VRRVKALESLAAAHQTSIANIVLAFYLTRPAIDVIIPGAKRAEQVIENIKAADIVLSDDE
    NCTC8325        VRRVKALESIAAAHQTSIANIVLAFYLTRPAIDVIIPGAKRAEQVVENIKAADIVLSDDE
    Newman          VRRVKALESIAAAHQTSIANIVLAFYLTRPAIDVIIPGAKRAEQVVENIKAADIVLSDDE
    USA300_FPR3757  VRRVKALESIAAAHQTSIANIVLAFYLTRPAIDVIIPGAKRAEQVVENIKAADIVLSDDE
                    *********:***********************************:**************

    COL             IQYIDELFPIED
    N315            IQYIDELFPIED
    NCTC8325        IQYIDELFPIED
    Newman          IQYIDELFPIED
    USA300_FPR3757  IQYIDELFPIED
                    ************