Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002475000
  • symbol?:
  • description?: endonuclease III

      descriptions from strain specific annotations:

    • endonuclease III
    • putative endonuclease III
    • deoxyribonuclease (pyrimidine dimer)
    • putative DNA repair protein
    • hhH-GPD superbase excision DNA repair family protein
    • HhH-GPD family protein
    • endonuclease III, putative
    • endonuclease III domain protein
    • hhH-GPD superfamily base excision DNA repair family protein
    • DNA repair endonuclease
    • DNA-lyase
  • strand?: +
  • coordinates?: 2991264..2992074
  • synteny block?: BlockID0017110
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0585
    08BA02176:
    C248_0692
    11819-97:
    MS7_0661
    71193:
    ST398NM01_0689
    ECT-R 2:
    ECTR2_561
    ED133:
    SAOV_0644
    ED98:
    SAAV_0572
    HO 5096 0412:
    SAEMRSA15_05360
    JH1:
    SaurJH1_0646
    JH9:
    SaurJH9_0631
    JKD6008:
    SAA6008_00626
    JKD6159:
    SAA6159_00565
    LGA251:
    SARLGA251_05440
    M013:
    M013TW_0597
    MRSA252:
    SAR0617
    MSHR1132:
    SAMSHR1132_05520
    MSSA476:
    SAS0576
    Mu3:
    SAHV_0606
    Mu50:
    SAV0608
    MW2:
    MW0572
    RF122:
    SAB0561
    ST398:
    SAPIG0689
    T0131:
    SAT0131_00675
    TCH60:
    HMPREF0772_12578
    TW20:
    SATW20_06850
    USA300_TCH1516:
    USA300HOU_0614
    VC40:
    SAVC_02685

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLGTDELYKVLYEHLGPQFWWPADNDIEMMLGAILVQNTRWRNAEIALNQIKEHTHFNPN
    N315            MLGTDELYKLLYRHMGPQNWWPADNDIELMLGAILVQNTRWRNAEIALNQIKEHTHFNPN
    NCTC8325        MLGTDELYKVLYEHLGPQFWWPADNDIEMMLGAILVQNTRWRNAEIALNQIKEHTHFNPN
    Newman          MLGTDELYKVLYEHLGPQFWWPADNDIEMMLGAILVQNTRWRNAEIALNQIKEHTHFNPN
    USA300_FPR3757  MLGTDELYKVLYEHLGPQFWWPADNDIEMMLGAILVQNTRWRNAEIALNQIKEHTHFNPN
                    *********:**.*:*** *********:*******************************

    COL             HILELPIETLQSLIHSSGFYKSKSLTIKTLLTWLARHHFNYQEINERYKGGLRKELLSLK
    N315            HILELPIETLQSLIHSSGFYKSKTLTIKTLLTWLARHHFNYQEINERYKGGLRKELLSLK
    NCTC8325        HILELPIETLQSLIHSSGFYKSKSLTIKTLLTWLARHHFNYQEINERYKGGLRKELLSLK
    Newman          HILELPIETLQSLIHSSGFYKSKSLTIKTLLTWLARHHFNYQEINERYKGGLRKELLSLK
    USA300_FPR3757  HILELPIETLQSLIHSSGFYKSKSLTIKTLLTWLARHHFNYQEINERYKGGLRKELLSLK
                    ***********************:************************************

    COL             GIGSETADVLLVYIFGRIEFIPDSYTRKIYDKLGYENTKNYDQLKKVVTLPNHFTNQDAN
    N315            GIGSETADVLLVYIFGRIEFIPDSYTRKIYDKLGYENTKNYDQLKKVVTLPNHFTNQDAN
    NCTC8325        GIGSETADVLLVYIFGRIEFIPDSYTRKIYDKLGYENTKNYDQLKKVVTLPNHFTNQDAN
    Newman          GIGSETADVLLVYIFGRIEFIPDSYTRKIYDKLGYENTKNYDQLKKVVTLPNHFTNQDAN
    USA300_FPR3757  GIGSETADVLLVYIFGRIEFIPDSYTRKIYDKLGYENTKNYDQLKKVVTLPNHFTNQDAN
                    ************************************************************

    COL             EFHALLDVFGKHYFRDKDIKNYDFLEPYFKK
    N315            EFHALLDVFGKHYFRDKDIKNYDFLEPYFKK
    NCTC8325        EFHALLDVFGKHYFRDKDIKNYDFLEPYFKK
    Newman          EFHALLDVFGKHYFRDKDIKNYDFLEPYFKK
    USA300_FPR3757  EFHALLDVFGKHYFRDKDIKNYDFLEPYFKK
                    *******************************