From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002488000
  • symbol?:
  • description?: pseudogene

      descriptions from strain specific annotations:

    • pseudogene
    • Integral membrane protein
    • membrane spanning protein
  • strand?: -
  • coordinates?: 3003689..3004634
  • synteny block?: BlockID0017240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0594
    08BA02176:
    C248_0701
    11819-97:
    MS7_0670
    71193:
    ST398NM01_0698
    ECT-R 2:
    ECTR2_570
    ED133:
    SAOV_0654c
    ED98:
    SAAV_0582
    HO 5096 0412:
    SAEMRSA15_05450
    JH1:
    SaurJH1_0656
    JH9:
    SaurJH9_0641
    JKD6008:
    SAA6008_00635
    JKD6159:
    SAA6159_00574
    LGA251:
    SARLGA251_05530
    M013:
    M013TW_0606
    MRSA252:
    SAR0626
    MSHR1132:
    SAMSHR1132_05610
    MSSA476:
    SAS0585
    Mu3:
    SAHV_0615
    Mu50:
    SAV0617
    MW2:
    MW0581
    RF122:
    SAB0570c
    ST398:
    SAPIG0698
    T0131:
    SAT0131_00685
    TCH60:
    HMPREF0772_12569
    TW20:
    SATW20_06940
    USA300_TCH1516:
    USA300HOU_0624
    VC40:
    SAVC_02730

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------MLIPIQTSVNSRLSLYTKSPFYTSFISFSVGTICLIILNIIINPEVFT
    N315            MLLFYIIGVLVGMLIPIQTSVNSRLSLYTKSPFYTSFISFSVGTICLIILNIIINPEVFT
    NCTC8325        ------------MLIPIQTSVNSRLSLYTKSPFYTSFISFSVGTICLIILNIIINPEVFT
    Newman          MLLFYIIGVLVGMLIPIQTSVNSRLSLYTKSPFYTSFISFSVGTICLIILNIIINPEVFT
    USA300_FPR3757  ------------MLIPIQTSVNSRLSLYTKSPFYTSFISFSVGTICLIILNIIINPEVFT
                                ************************************************

    COL             IHFYNNQSFNYTWVVGGLLGVSFLTGNLLLLPKLGATLTVIATVAGQIIMGVIIDTFGLF
    N315            IHFYNNQSFNYTWVVGGLLGVSFLTGNLLLLPKLGATLTVIATVAGQIIMGVIIDTFGLF
    NCTC8325        IHFYNNQSFNYTWVVGGLLGVSFLTGNLLLLPKLGATLTVIATVAGQIIMGVIIDTFGLF
    Newman          IHFYNNQSFNYTWVVGGLLGVSFLTGNLLLLPKLGATLTVIATVAGQIIMGVIIDTFGLF
    USA300_FPR3757  IHFYNNQSFNYTWVVGGLLGVSFLTGNLLLLPKLGATLTVIATVAGQIIMGVIIDTFGLF
                    ************************************************************

    COL             GATIHDFNLIKAIGVLLLIVGIVIMNQFNKNNLLLTDQKYLLFWLLLGFIFGFFPPIQTT
    N315            GATIHDFNLIKAIGVLLLIVGIVIMNQFNKNNLLLTDQKYLLFWLLLGFIFGFFPPIQTT
    NCTC8325        GATIHDFNLIKAIGVLLLIVGIVIMNQFNKNNLLLTDQKYLLFWLLLGFIFGFFPPIQTT
    Newman          GATIHDFNLIKAIGVLLLIVGIVIMNQFNKNNLLLTDQKYLLFWLLLGFIFGFFPPIQTT
    USA300_FPR3757  GATIHDFNLIKAIGVLLLIVGIVIMNQFNKNNLLLTDQKYLLFWLLLGFIFGFFPPIQTT
                    ************************************************************

    COL             INSALASHTHSPAFASLVSFTIGSIALLILTAIFNRSLKLKTSHLKFGKLKPIYFTGGIL
    N315            INSALASHTHSPAFASLVSFTIGSITLLILTAIFNSSLKLKTSHLKFGKLKPIYFTGGIL
    NCTC8325        INSALASHTHSPAFASLVSFTIGSIALLILTAIFNRSLKLKTSHLKFGKLKPIYFTGGIL
    Newman          INSALASHTHSPAFASLVSFTIGSIALLILTAIFNRSLKLKTSHLKFGKLKPIYFTGGIL
    USA300_FPR3757  INSALASHTHSPAFASLVSFTIGSIALLILTAIFNRSLKLKTSHLKFGKLKPIYFTGGIL
                    *************************:********* ************************

    COL             GMAFVTANIILMPHMGAALTTLIGMFGQILMGILIDHFGLFGSPKIAMTSRKTIGLLCIL
    N315            GMAFVTANIILMPHMGAALTTLIGMFGQILMGILIDHFGLFGSPKIAMTSRKTIGLLCIL
    NCTC8325        GMAFVTANIILMPHMGAALTTLIGMFGQILMGILIDHFGLFGSPKIAMTSRKTIGLLCIL
    Newman          GMAFVTANIILMPHMGAALTTLIGMFGQILMGILIDHFGLFGSPKIAMTSRKTIGLLCIL
    USA300_FPR3757  GMAFVTANIILMPHMGAALTTLIGMFGQILMGILIDHFGLFGSPKIAMTSRKTIGLLCIL
                    ************************************************************

    COL             TGIILLRLF
    N315            TGIILLRLF
    NCTC8325        TGIILLRLF
    Newman          TGIILLRLF
    USA300_FPR3757  TGIILLRLF
                    *********