From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002490000
  • symbol?:
  • description?: DUF2922 domain-containing protein

      descriptions from strain specific annotations:

    • DUF2922 domain-containing protein
    • pseudogene
  • strand?: -
  • coordinates?: 3004874..3005098
  • synteny block?: BlockID0017260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0595
    08BA02176:
    C248_0702
    11819-97:
    MS7_0671
    71193:
    ST398NM01_0699
    ECT-R 2:
    ECTR2_571
    ED133:
    SAOV_0655c
    ED98:
    SAAV_0583
    HO 5096 0412:
    SAEMRSA15_05460
    JH1:
    SaurJH1_0657
    JH9:
    SaurJH9_0642
    JKD6008:
    SAA6008_00637
    JKD6159:
    SAA6159_00575
    LGA251:
    SARLGA251_05540
    M013:
    M013TW_0607
    MRSA252:
    SAR0627
    MSHR1132:
    SAMSHR1132_05630
    MSSA476:
    SAS0586
    Mu3:
    SAHV_0616
    Mu50:
    SAV0618
    MW2:
    MW0582
    RF122:
    SAB0571c
    ST398:
    SAPIG0699
    T0131:
    SAT0131_00687
    TCH60:
    HMPREF0772_12568
    TW20:
    SATW20_06950
    USA300_TCH1516:
    USA300HOU_0640
    VC40:
    SAVC_02735

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------------------------------MTKTLELSFKSSLDKPVKLQL
    N315            ---------------------------------------MTKTLELSFKSSLDKPVKLQL
    NCTC8325        ---------------------------------------MTKTLELSFKSSLDKPVKLQL
    Newman          MHQTTKLKHSANLLSDLLEKHIAISNSSNLYQFNQEDIFMTKTLELSFKSSLDKPVKLQL
    USA300_FPR3757  ---------------------------------------MTKTLELSFKSSLDKPVKLQL
                                                           *********************

    COL             PQLNNVVTEQVARDSMNALVDLNIIKSNSGTITKVHSAQIIDKTTTVLFEDKK
    N315            PQLNNVVTEQVARDSMNALVDLNIIKSNSGTITKVHSAQIIDKTTTVLFEDKK
    NCTC8325        PQLNNVVTEQVARDSMNALVDLNIIKSNSGTITKVHSAQIIDKTTTVLFEDKK
    Newman          PQLNNVVTEQVARDSMNALVDLNIIKSNSGTITKVHSAQIIDKTTTVLFEDKK
    USA300_FPR3757  PQLNNVVTEQVARDSMNALVDLNIIKSNSGTITKVHSAQIIDKTTTVLFEDKK
                    *****************************************************