From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002508000
  • symbol?: mntB
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • iron (chelated) ABC transporter permease
    • ABC transporter ATP-binding protein
    • Manganese ABC transporter, inner membrane permease protein SitD
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • manganese transport system membrane protein
    • ABC-3 protein
    • fecCD transport family protein
    • AfeD
    • cation ABC transporter
  • strand?: -
  • coordinates?: 3021579..3022457
  • synteny block?: BlockID0017440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0608 (sitD)
    08BA02176:
    C248_0714
    11819-97:
    MS7_0683
    71193:
    ST398NM01_0711
    ECT-R 2:
    ECTR2_584
    ED133:
    SAOV_0667c
    ED98:
    SAAV_0595
    HO 5096 0412:
    SAEMRSA15_05580
    JH1:
    SaurJH1_0670
    JH9:
    SaurJH9_0655
    JKD6008:
    SAA6008_00649 (mntB)
    JKD6159:
    SAA6159_00587 (mntB)
    LGA251:
    SARLGA251_05660 (mntB)
    M013:
    M013TW_0620
    MRSA252:
    SAR0642
    MSHR1132:
    SAMSHR1132_05780
    MSSA476:
    SAS0598
    Mu3:
    SAHV_0629
    Mu50:
    SAV0632
    MW2:
    MW0594
    RF122:
    SAB0582c (mntB)
    ST398:
    SAPIG0711
    T0131:
    SAT0131_00701
    TCH60:
    HMPREF0772_12555
    TW20:
    SATW20_07070 (mntB)
    USA300_TCH1516:
    USA300HOU_0652
    VC40:
    SAVC_02795

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLEFVEHLFTYQFLNRALITSIIVGIVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFL
    N315            MLEFVEHLFTYQFLNRALITSIIVGIVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFL
    NCTC8325        MLEFVEHLFTYQFLNRALITSIIVGIVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFL
    Newman          MLEFVEHLFTYQFLNRALITSIIVGIVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFL
    USA300_FPR3757  MLEFVEHLFTYQFLNRALITSIIVGIVCGTVGSLIVLRGLSLMGDAMSHAVLPGVALSFL
                    ************************************************************

    COL             FGIPMFVGALITGMIASIFIGYITSSSKTKPDAAIGISFTAFLASGIIIISLINTTTDLY
    N315            FGIPMFVGALITGMIASIFIGYITSSSKTKPDAAIGISFTAFLASGIIIISLINTTTDLY
    NCTC8325        FGIPMFVGALITGMIASIFIGYITSSSKTKPDAAIGISFTAFLASGIIIISLINTTTDLY
    Newman          FGIPMFVGALITGMIASIFIGYITSSSKTKPDAAIGISFTAFLASGIIIISLINTTTDLY
    USA300_FPR3757  FGIPMFVGALITGMIASIFIGYITSSSKTKPDAAIGISFTAFLASGIIIISLINTTTDLY
                    ************************************************************

    COL             HILFGNLLAITNSAFLTTIVIGSIVLILIIIFYRPLMISTFDPTFSRMSGLNTTLLHYFV
    N315            HILFGNLLAITNSAFLTTIVIGSIVLILIIIFYRPLMISTFDPTFSRMSGLNTTLLHYFV
    NCTC8325        HILFGNLLAITNSAFLTTIVIGSIVLILIIIFYRPLMISTFDPTFSRMSGLNTTLLHYFV
    Newman          HILFGNLLAITNSAFLTTIVIGSIVLILIIIFYRPLMISTFDPTFSRMSGLNTTLLHYFV
    USA300_FPR3757  HILFGNLLAITNSAFLTTIVIGSIVLILIIIFYRPLMISTFDPTFSRMSGLNTTLLHYFV
                    ************************************************************

    COL             MLLLSLVTVASIQTVGIILVVALLITPASTAFLISKKLYSMMIIASLISVISSIVGLYYS
    N315            MLLLSLVTVASIQTVGIILVVALLITPASTAFLISKKLYSMMIIASLISVISSIVGLYYS
    NCTC8325        MLLLSLVTVASIQTVGIILVVALLITPASTAFLISKKLYSMMIIASLISVISSIVGLYYS
    Newman          MLLLSLVTVASIQTVGIILVVALLITPASTAFLISKKLYSMMIIASLISVISSIVGLYYS
    USA300_FPR3757  MLLLSLVTVASIQTVGIILVVALLITPASTAFLISKKLYSMMIIASLISVISSIVGLYYS
                    ************************************************************

    COL             YIYNIPSGATIVLCTFVIYIITLFFTKFTNRKKRGSLT
    N315            YIYNIPSGATIVLCTFVIYIITLFFTKFTNRKKRGSLT
    NCTC8325        YIYNIPSGATIVLCTFVIYIITLFFTKFTNRKKRGSLT
    Newman          YIYNIPSGATIVLCTFVIYIITLFFTKFTNRKKRGSLT
    USA300_FPR3757  YIYNIPSGATIVLCTFVIYIITLFFTKFTNRKKRGSLT
                    **************************************