From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002546000
  • symbol?:
  • description?: Integral membrane protein interacts with FtsH-like protein

      descriptions from strain specific annotations:

    • Integral membrane protein interacts with FtsH-like protein
    • inhibitor of apoptosis-promoting Bax1 family protein
    • transporter
  • strand?: +
  • coordinates?: 3059952..3060641
  • synteny block?: BlockID0017820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0642
    08BA02176:
    C248_0750
    11819-97:
    MS7_0716
    71193:
    ST398NM01_0744
    ECT-R 2:
    ECTR2_617
    ED133:
    SAOV_0700
    ED98:
    SAAV_0628
    HO 5096 0412:
    SAEMRSA15_05920
    JH1:
    SaurJH1_0705
    JH9:
    SaurJH9_0690
    JKD6008:
    SAA6008_00682
    JKD6159:
    SAA6159_00620
    LGA251:
    SARLGA251_05990
    M013:
    M013TW_0653
    MRSA252:
    SAR0676
    MSHR1132:
    SAMSHR1132_06120
    MSSA476:
    SAS0631
    Mu3:
    SAHV_0663
    Mu50:
    SAV0666
    MW2:
    MW0628
    RF122:
    SAB0615
    ST398:
    SAPIG0744
    T0131:
    SAT0131_00736
    TCH60:
    HMPREF0772_12522
    TW20:
    SATW20_07410
    USA300_TCH1516:
    USA300HOU_0687
    VC40:
    SAVC_02960

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQNTNHSYYHQNQHAQSISKVWLYFMYYWIIFGIGCYLGQFLPLSWRQPLSFGLLIIIL
    N315            MSQNTNHSYYHQNQHAQSISKVWLYFMYYWIIFGIGCYLGQFLPLSWRQPLSFGLLIIIL
    NCTC8325        MSQNTNHSYYHQNQHAQSISKVWLYFMYYWIIFGIGCYLGQFLPLSWRQPLSFGLLIIIL
    Newman          MSQNTNHSYYHQNQHAQSISKVWLYFMYYWIIFGIGCYLGQFLPLSWRQPLSFGLLIIIL
    USA300_FPR3757  MSQNTNHSYYHQNQHAQSISKVWLYFMYYWIIFGIGCYLGQFLPLSWRQPLSFGLLIIIL
                    ************************************************************

    COL             ATLVFERARRFGLIISHIYAVVIGLLSYATFTTYLQNLGPDIFYKNIALAIFAFIAFGII
    N315            ATLVFERARRFGLIISHIYAVVIGLLSYATFTTYLQNLGPDIFYKNIALAIFAFIAFGII
    NCTC8325        ATLVFERARRFGLIISHIYAVVIGLLSYATFTTYLQNLGPDIFYKNIALAIFAFIAFGII
    Newman          ATLVFERARRFGLIISHIYAVVIGLLSYATFTTYLQNLGPDIFYKNIALAIFAFIAFGII
    USA300_FPR3757  ATLVFERARRFGLIISHIYAVVIGLLSYATFTTYLQNLGPDIFYKNIALAIFAFIAFGII
                    ************************************************************

    COL             GYFFVGDASSIGKYLFVTLITLIIASLIGIFLQNPIFYTIITVVSLLLFLLYTLYDFNRL
    N315            GYFFVGDASSIGKYLFVTLITLIIASLIGIFLQNPIFYTIITVVSLLLFLLYTLYDFNRL
    NCTC8325        GYFFVGDASSIGKYLFVTLITLIIASLIGIFLQNPIFYTIITVVSLLLFLLYTLYDFNRL
    Newman          GYFFVGDASSIGKYLFVTLITLIIASLIGIFLQNPIFYTIITVVSLLLFLLYTLYDFNRL
    USA300_FPR3757  GYFFVGDASSIGKYLFVTLITLIIASLIGIFLQNPIFYTIITVVSLLLFLLYTLYDFNRL
                    ************************************************************

    COL             KRGDYSPREMGFNLFINLLNIIKDILYLANMFRR
    N315            KRGDYSPREMGFNLFINLLNIIKDILYLANMFRR
    NCTC8325        KRGDYSPREMGFNLFINLLNIIKDILYLANMFRR
    Newman          KRGDYSPREMGFNLFINLLNIIKDILYLANMFRR
    USA300_FPR3757  KRGDYSPREMGFNLFINLLNIIKDILYLANMFRR
                    **********************************