From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002557000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • membrane protein , putative
    • pseudogene
  • strand?: +
  • coordinates?: 3070432..3070899
  • synteny block?: BlockID0017930
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0651
    08BA02176:
    C248_0759
    11819-97:
    MS7_0726
    71193:
    ST398NM01_0752
    ECT-R 2:
    ECTR2_626
    ED133:
    SAOV_0709
    ED98:
    SAAV_0637
    HO 5096 0412:
    SAEMRSA15_06000
    JH1:
    SaurJH1_0714
    JH9:
    SaurJH9_0698
    JKD6008:
    SAA6008_00691
    JKD6159:
    SAA6159_00629
    LGA251:
    SARLGA251_06070
    M013:
    M013TW_0661
    MRSA252:
    MSHR1132:
    SAMSHR1132_06200
    MSSA476:
    SAS0639
    Mu3:
    SAHV_0671
    Mu50:
    SAV0674
    MW2:
    MW0636
    RF122:
    SAB0623
    ST398:
    SAPIG0752
    T0131:
    SAT0131_00745
    TCH60:
    HMPREF0772_12514
    TW20:
    SATW20_07490
    USA300_TCH1516:
    USA300HOU_0697
    VC40:
    SAVC_03000

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTIILWLLIIAAFMLAFVGLIKPIIPSVLVLWVGFLIYQFGFHNQHLSWVFYVSMALLTI
    N315            MTIILWLLIIAAFMLAFVGLIKPIIPSVLVLWVGFLIYQFGFHNQHLSWVFYVSMALLTI
    NCTC8325        MTIILWLLIIAAFMLAFVGLIKPIIPSVLVLWVGFLIYQFGFHNQHLSWVFYVSMALLTI
    Newman          MTIILWLLIIAAFMLAFVGLIKPIIPSVLVLWVGFLIYQFGFHNQHLSWVFYVSMALLTI
    USA300_FPR3757  MTIILWLLIIAAFMLAFVGLIKPIIPSVLVLWVGFLIYQFGFHNQHLSWVFYVSMALLTI
                    ************************************************************

    COL             LILCADFLANKYFVNRFGGSKFGEYAALIGVVIGCFVLPPFGIIIIPFILVFIVELIQGY
    N315            LILCADFLANKYFVNRFGGSKFGEYAALIGVVIGCFVLPPFGIIIIPFILVFIVELIQGY
    NCTC8325        LILCADFLANKYFVNRFGGSKFGEYAALIGVVIGCFVLPPFGIIIIPFILVFIVELIQGY
    Newman          LILCADFLANKYFVNRFGGSKFGEYAALIGVVIGCFVLPPFGIIIIPFILVFIVELIQGY
    USA300_FPR3757  LILCADFLANKYFVNRFGGSKFGEYAALIGVVIGCFVLPPFGIIIIPFILVFIVELIQGY
                    ************************************************************

    COL             SFERAVKVSIGSIVAFLTSSIAQAIIMFIMIVWFFIDALLIN
    N315            SFERAVKVSIGSIVAFLTSSIAQAIIMFIMIVWFFIDALLIN
    NCTC8325        SFERAVKVSIGSIVAFLTSSIAQAIIMFIMIVWFFIDALLIN
    Newman          SFERAVKVSIGSIVAFLTSSIAQAIIMFIMIVWFFIDALLIN
    USA300_FPR3757  SFERAVKVSIGSIVAFLTSSIAQAIIMFIMIVWFFIDALLIN
                    ******************************************