Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002565000
  • symbol?:
  • description?: UPF0178 protein

      descriptions from strain specific annotations:

    • UPF0178 protein
    • YaiI/YqxD family protein
    • EMG2 protein
    • protein BCE33L2782
  • strand?: -
  • coordinates?: 3076427..3076885
  • synteny block?: BlockID0018010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0658
    08BA02176:
    C248_0766
    11819-97:
    MS7_0733
    71193:
    ST398NM01_0759
    ECT-R 2:
    ECTR2_633
    ED133:
    SAOV_0716c
    ED98:
    SAAV_0644
    HO 5096 0412:
    SAEMRSA15_06070
    JH1:
    SaurJH1_0721
    JH9:
    SaurJH9_0705
    JKD6008:
    SAA6008_00698
    JKD6159:
    SAA6159_00636
    LGA251:
    SARLGA251_06140
    M013:
    M013TW_0668
    MRSA252:
    SAR0734
    MSHR1132:
    SAMSHR1132_06270
    MSSA476:
    SAS0646
    Mu3:
    SAHV_0678
    Mu50:
    SAV0681
    MW2:
    MW0643
    RF122:
    SAB0630c
    ST398:
    SAPIG0759
    T0131:
    SAT0131_00752 (fadA)
    TCH60:
    HMPREF0772_12506
    TW20:
    SATW20_07560
    USA300_TCH1516:
    USA300HOU_0704
    VC40:
    SAVC_03035

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTHIIIDGDACPVVDSIIDLTTETGIFVTIIRSFSHFSNQLYPPHVSTLYVDDGPDAVDY
    N315            MTHIIIDGDACPVVDSIIDLTTETGIFVTIIRSFSHFSNQLYPPHVSTLYVDDGPDAVDY
    NCTC8325        MTHIIIDGDACPVVDSIIDLTTETGIFVTIIRSFSHFSNQLYPPHVSTLYVDDGPDAVDY
    Newman          MTHIIIDGDACPVVDSIIDLTTETGIFVTIIRSFSHFSNQLYPPHVSTLYVDDGPDAVDY
    USA300_FPR3757  MTHIIIDGDACPVVDSIIDLTTETGIFVTIIRSFSHFSNQLYPPHVSTLYVDDGPDAVDY
                    ************************************************************

    COL             KIVQLSTKDDIVVTQDYGLASLLVDKVLIVMHHNGKIYNSKNIQQLLDKRYMNAQIRKQG
    N315            KIVQLSTKDDIVVTQDYGLASLLVDKVLIVMHHNGKIYNSKNIQQLLDKRYINAQIRKQG
    NCTC8325        KIVQLSTKDDIVVTQDYGLASLLVDKVLIVMHHNGKIYNSKNIQQLLDKRYMNAQIRKQG
    Newman          KIVQLSTKDDIVVTQDYGLASLLVDKVLIVMHHNGKIYNSKNIQQLLDKRYMNAQIRKQG
    USA300_FPR3757  KIVQLSTKDDIVVTQDYGLASLLVDKVLIVMHHNGKIYNSKNIQQLLDKRYMNAQIRKQG
                    ***************************************************:********

    COL             GRHKGPPPFTKQDQKVFEQSLLKVIHRIKELD
    N315            GRHKGPPPFTKQDQKVFEQSLLKVIHRIKELD
    NCTC8325        GRHKGPPPFTKQDQKVFEQSLLKVIHRIKELD
    Newman          GRHKGPPPFTKQDQKVFEQSLLKVIHRIKELD
    USA300_FPR3757  GRHKGPPPFTKQDQKVFEQSLLKVIHRIKELD
                    ********************************