From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002571000
  • symbol?:
  • description?: cobalamin synthesis-like protein

      descriptions from strain specific annotations:

    • cobalamin synthesis-like protein
    • cobalamin synthesis protein, P47K
    • cobalamin synthesis protein P47K
    • cobalamin synthesis protein/P47K family protein
    • Putative GTPases (G3E family)
    • cobW/HypB/UreG, nucleotide-binding domain protein
    • cobalamin synthesis protein, P47K family protein
    • cobalamin (vitamin B12) biosynthesis protein
    • putative cobalamin synthesis protein
    • putative G3E family GTPase
    • cobalamin synthesis-related protein
    • putative metal chaperone, GTPase
    • Low-affinity zinc transport protein
  • strand?: +
  • coordinates?: 3082956..3083897
  • synteny block?: BlockID0018070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0664
    08BA02176:
    C248_0772
    11819-97:
    MS7_0739
    71193:
    ST398NM01_0765
    ECT-R 2:
    ECTR2_639
    ED133:
    SAOV_0722
    ED98:
    SAAV_0650
    HO 5096 0412:
    SAEMRSA15_06130
    JH1:
    SaurJH1_0727
    JH9:
    SaurJH9_0711
    JKD6008:
    SAA6008_00704
    JKD6159:
    SAA6159_00642
    LGA251:
    SARLGA251_06200
    M013:
    M013TW_0674
    MRSA252:
    SAR0740
    MSHR1132:
    SAMSHR1132_06330
    MSSA476:
    SAS0652
    Mu3:
    SAHV_0684
    Mu50:
    SAV0687
    MW2:
    MW0649
    RF122:
    SAB0636
    ST398:
    SAPIG0765
    T0131:
    SAT0131_00758
    TCH60:
    HMPREF0772_12500
    TW20:
    SATW20_07620
    USA300_TCH1516:
    USA300HOU_0710 (cobW2)
    VC40:
    SAVC_03070

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNNKDEKIRISIINGFLGSGKTTLLTHYISELLKNDEKIKIIMNEFGTFDIDSNSISNE
    N315            MKNNKDEKIRISIINGFLGSGKTTLLTHYISELLKNDEKIKIIMNEFGTFDIDSNSISNE
    NCTC8325        MKNNKDEKIRISIINGFLGSGKTTLLTHYISELLKNDEKIKIIMNEFGTFDIDSNSISNE
    Newman          MKNNKDEKIRISIINGFLGSGKTTLLTHYISELLKNDEKIKIIMNEFGTFDIDSNSISNE
    USA300_FPR3757  MKNNKDEKIRISIINGFLGSGKTTLLTHYISELLKNDEKIKIIMNEFGTFDIDSNSISNE
                    ************************************************************

    COL             IEVHSLINGCVCCDLKQELVYELKAIALKGDVNHVIIEATGIAHPLELLVACQDPQIVNF
    N315            IEVHSLINGCVCCDLKQELVYELKAIALKGDVNHVIIEATGIAHPLELLVACQDPQIVNF
    NCTC8325        IEVHSLINGCVCCDLKQELVYELKAIALKGDVNHVIIEATGIAHPLELLVACQDPQIVNF
    Newman          IEVHSLINGCVCCDLKQELVYELKAIALKGDVNHVIIEATGIAHPLELLVACQDPQIVNF
    USA300_FPR3757  IEVHSLINGCVCCDLKQELVYELKAIALKGDVNHVIIEATGIAHPLELLVACQDPQIVNF
                    ************************************************************

    COL             FEKPIIYGVLDATRFLERHQYTENTVSLMEDQLKLSDMIIINKIDLITDDSLEKIDKQLG
    N315            FEKPIIYGVLDATRFLERHQYTENTVSLMEEQLKLSDMIIINKIDLITDDSLEKIDKQLG
    NCTC8325        FEKPIIYGVLDATRFLERHQYTENTVSLMEDQLKLSDMIIINKIDLITDDSLEKIDKQLG
    Newman          FEKPIIYGVLDATRFLERHQYTENTVSLMEDQLKLSDMIIINKIDLITDDSLEKIDKQLG
    USA300_FPR3757  FEKPIIYGVLDATRFLERHQYTENTVSLMEDQLKLSDMIIINKIDLITDDSLEKIDKQLG
                    ******************************:*****************************

    COL             MICASIPTYKTTYGKVSLEELDLTVKDREISSHHHHHHGIKSMTYTFTGPIDRHLFYQFI
    N315            MICASIPTYKTTYGKVSLEELDLTVKDREISSHHHHHHGIKSMTYTFTGPIDRQLFYQFI
    NCTC8325        MICASIPTYKTTYGKVSLEELDLTVKDREISSHHHHHHGIKSMTYTFTGPIDRHLFYQFI
    Newman          MICASIPTYKTTYGKVSLEELDLTVKDREISSHHHHHHGIKSMTYTFTGPIDRHLFYQFI
    USA300_FPR3757  MICASIPTYKTTYGKVSLEELDLTVKDREISSHHHHHHGIKSMTYTFTGPIDRHLFYQFI
                    *****************************************************:******

    COL             MKLPESVLRLKGYVSFRDQPNAIYEFQYAYGLPDYGIIGMQLPLTIVIIGETLDTNHIRN
    N315            MKLPESVLRLKGYVSFRNQPNAIYEFQYAYGLPDYGIIGMQLPLTIVIIGETLDTNHIRN
    NCTC8325        MKLPESVLRLKGYVSFRDQPNAIYEFQYAYGLPDYGIIGMQLPLTIVIIGETLDTNHIRN
    Newman          MKLPESVLRLKGYVSFRDQPNAIYEFQYAYGLPDYGIIGMQLPLTIVIIGETLDTNHIRN
    USA300_FPR3757  MKLPESVLRLKGYVSFRDQPNAIYEFQYAYGLPDYGIIGMQLPLTIVIIGETLDTNHIRN
                    *****************:******************************************

    COL             QLDMLQFT
    N315            QLDMLQFT
    NCTC8325        QLDMLQFT
    Newman          QLDMLQFT
    USA300_FPR3757  QLDMLQFT
                    ********