From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002574000
  • symbol?:
  • description?: TetR family transcriptional regulator

      descriptions from strain specific annotations:

    • TetR family transcriptional regulator
    • anion transporter
    • anion transporter family protein
    • Sodium/di- and tricarboxylate cotransporter
    • transporter, divalent anion:Na+ symporter (DASS) family protein
    • sodium:sulfate symporter protein
    • DASS family divalent anion:sodium (Na+) symporter
    • putative sodium:sulfate symporter protein
    • Na+ symporter family protein
    • divalent anion:sodium symporter family transporter
    • membrane transporter
    • divalent anion symporter
  • strand?: +
  • coordinates?: 3085507..3087120
  • synteny block?: BlockID0018100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0667
    08BA02176:
    C248_0775
    11819-97:
    MS7_0742
    71193:
    ST398NM01_0768
    ECT-R 2:
    ECTR2_642
    ED133:
    SAOV_0725
    ED98:
    SAAV_0653
    HO 5096 0412:
    SAEMRSA15_06160
    JH1:
    SaurJH1_0730
    JH9:
    SaurJH9_0714
    JKD6008:
    SAA6008_00707
    JKD6159:
    SAA6159_00645
    LGA251:
    SARLGA251_06230
    M013:
    M013TW_0677
    MRSA252:
    SAR0743
    MSHR1132:
    SAMSHR1132_06360
    MSSA476:
    SAS0655
    Mu3:
    SAHV_0687
    Mu50:
    SAV0690
    MW2:
    MW0652
    RF122:
    SAB0639
    ST398:
    SAPIG0768
    T0131:
    SAT0131_00761
    TCH60:
    HMPREF0772_12497
    TW20:
    SATW20_07650
    USA300_TCH1516:
    USA300HOU_0713
    VC40:
    SAVC_03085

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEEKHVVEHEQQKKEKTKKQYKPFWIVMSFIILIVVLLLPAPSSLPIMAKAVLAILAFA
    N315            MSEEKHVVEHEQQKKEKTKKQYKPFWIVMSFIILIVVLLLPAPSSLPIMAKAVLAILAFA
    NCTC8325        MSEEKHVVEHEQQKKEKTKKQYKPFWIVMSFIILIVVLLLPAPSSLPIMAKAVLAILAFA
    Newman          MSEEKHVVEHEQQKKEKTKKQYKPFWIVMSFIILIVVLLLPAPSSLPIMAKAVLAILAFA
    USA300_FPR3757  MSEEKHVVEHEQQKKEKTKKQYKPFWIVMSFIILIVVLLLPAPSSLPIMAKAVLAILAFA
                    ************************************************************

    COL             VIMWVTEAVSYPVSATLIIGLMILLLGFSPVQNLGEKLGNPKSGSAILAGSDLLGTNHAL
    N315            VIMWVTEAVSYPVSATLIIGLMILLLGFSPVQNLGEKLGNPKSGSAILAGSDLLGTNHAL
    NCTC8325        VIMWVTEAVSYPVSATLIIGLMILLLGFSPVQNLGEKLGNPKSGSAILAGSDLLGTNHAL
    Newman          VIMWVTEAVSYPVSATLIIGLMILLLGFSPVQNLGEKLGNPKSGSAILAGSDLLGTNHAL
    USA300_FPR3757  VIMWVTEAVSYPVSATLIIGLMILLLGFSPVQNLGEKLGNPKSGSAILAGSDLLGTNHAL
                    ************************************************************

    COL             SLAFSGFATSAVALVAAALFLAAAMQETNLHKRLALLVLSIVGNKTRNIVIGAIIVSIVL
    N315            SLAFSGYATSAVALVAAALFLAAAMQETNLHKRLALLVLSIVGNKTRNIVIGAIIVSIVL
    NCTC8325        SLAFSGFATSAVALVAAALFLAAAMQETNLHKRLALLVLSIVGNKTRNIVIGAIIVSIVL
    Newman          SLAFSGFATSAVALVAAALFLAAAMQETNLHKRLALLVLSIVGNKTRNIVIGAIIVSIVL
    USA300_FPR3757  SLAFSGFATSAVALVAAALFLAAAMQETNLHKRLALLVLSIVGNKTRNIVIGAIIVSIVL
                    ******:*****************************************************

    COL             AFFVPSATARAGAVVPILLGMIAAFKVSKDSKLASLLIITSVQAVSIWNIGIKTAAAQNI
    N315            AFFVPSATARAGAVVPILLGMIAAFKVSKDSKLASLLIITSVQAVSIWNIGIKTAAAQNI
    NCTC8325        AFFVPSATARAGAVVPILLGMIAAFKVSKDSKLASLLIITSVQAVSIWNIGIKTAAAQNI
    Newman          AFFVPSATARAGAVVPILLGMIAAFKVSKDSKLASLLIITSVQAVSIWNIGIKTAAAQNI
    USA300_FPR3757  AFFVPSATARAGAVVPILLGMIAAFKVSKDSKLASLLIITSVQAVSIWNIGIKTAAAQNI
                    ************************************************************

    COL             VAINFINHQLGFDVSWGEWFLYAAPWSIVMSVALYFIMIKVMPPEINTIEGGKDLIKEEL
    N315            VAINFINHQLGFDVSWGEWFLYAAPWSIVMSVALYFIMIKVMPPEINTIEGGKDLIKEEL
    NCTC8325        VAINFINHQLGFDVSWGEWFLYAAPWSIVMSVALYFIMIKVMPPEINTIEGGKDLIKEEL
    Newman          VAINFINHQLGFDVSWGEWFLYAAPWSIVMSVALYFIMIKVMPPEINTIEGGKDLIKEEL
    USA300_FPR3757  VAINFINHQLGFDVSWGEWFLYAAPWSIVMSVALYFIMIKVMPPEINTIEGGKDLIKEEL
                    ************************************************************

    COL             HKLGPVSPREWRLIVISMLLLLFWSTEKVLHPIDSASITIIALGVMLMPKIGVMTWKHVE
    N315            HKLGPVSPREWRLIVISMLLLLFWSTEKVLHPIDSASITIIALGVMLMPKIGVMTWKHVE
    NCTC8325        HKLGPVSPREWRLIVISMLLLLFWSTEKVLHPIDSASITIIALGVMLMPKIGVMTWKHVE
    Newman          HKLGPVSPREWRLIVISMLLLLFWSTEKVLHPIDSASITIIALGVMLMPKIGVMTWKHVE
    USA300_FPR3757  HKLGPVSPREWRLIVISMLLLLFWSTEKVLHPIDSASITIIALGVMLMPKIGVMTWKHVE
                    ************************************************************

    COL             NKIPWGTIIVFGVGISLGNVLLKTGAAQWLSDQTFGVLGLKHLPIIATIALITLFNILIH
    N315            NKIPWGTIIVFGVGISLGNVLLKTGAAQWLSDQTFGVLGLKHLPIIATIALITLFNILIH
    NCTC8325        NKIPWGTIIVFGVGISLGNVLLKTGAAQWLSDQTFGVLGLKHLPIIATIALITLFNILIH
    Newman          NKIPWGTIIVFGVGISLGNVLLKTGAAQWLSDQTFGVLGLKHLPIIATIALITLFNILIH
    USA300_FPR3757  NKIPWGTIIVFGVGISLGNVLLKTGAAQWLSDQTFGVLGLKHLPIIATIALITLFNILIH
                    ************************************************************

    COL             LGFASATSLSSALIPVFISLTSTLHLGDQSIGFVLIQQFVISFGFLLPVSAPQNMLAYGT
    N315            LGFASATSLSSALIPVFISLTSTLHLGDQSIGFVLIQQFVISFGFLLPVSAPQNMLAYGT
    NCTC8325        LGFASATSLSSALIPVFISLTSTLHLGDQSIGFVLIQQFVISFGFLLPVSAPQNMLAYGT
    Newman          LGFASATSLSSALIPVFISLTSTLHLGDQSIGFVLIQQFVISFGFLLPVSAPQNMLAYGT
    USA300_FPR3757  LGFASATSLSSALIPVFISLTSTLHLGDQSIGFVLIQQFVISFGFLLPVSAPQNMLAYGT
                    ************************************************************

    COL             GTFTVKDFLKAGIPLTIVGYILVIVFSMTYWKWLGLL
    N315            GTFTVKDFLKAGIPLTIVGYILVIVFSMTYWKWLGLL
    NCTC8325        GTFTVKDFLKAGIPLTIVGYILVIVFSMTYWKWLGLL
    Newman          GTFTVKDFLKAGIPLTIVGYILVIVFSMTYWKWLGLL
    USA300_FPR3757  GTFTVKDFLKAGIPLTIVGYILVIVFSMTYWKWLGLL
                    *************************************