From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002582000
  • symbol?: fruR
  • description?: DeoR/GlpR transcriptional regulator

      descriptions from strain specific annotations:

    • DeoR/GlpR transcriptional regulator
    • DeoR family transcriptional regulator
    • fructose operon transcriptional regulator
    • bacterial regulatory s, deoR family protein
    • DeoR family regulatory protein
    • deoR-like helix-turn-helix domain protein
    • DeoR ramily regulatory protein
    • fructose operon transcriptional repressor
    • fructose repressor
    • lactose PTS family porter repressor
    • transcriptional repressor of fructose operon
    • Transcriptional repressor of the fructose operon, DeoR family
    • transcription repressor of fructose operon
  • strand?: +
  • coordinates?: 3094054..3094821
  • synteny block?: BlockID0018180
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0675 (deoR)
    08BA02176:
    C248_0782
    11819-97:
    MS7_0749
    71193:
    ST398NM01_0775
    ECT-R 2:
    ECTR2_649
    ED133:
    SAOV_0732
    ED98:
    SAAV_0660
    HO 5096 0412:
    SAEMRSA15_06240
    JH1:
    SaurJH1_0738
    JH9:
    SaurJH9_0722
    JKD6008:
    SAA6008_00714
    JKD6159:
    SAA6159_00653
    LGA251:
    SARLGA251_06310
    M013:
    M013TW_0684
    MRSA252:
    SAR0751
    MSHR1132:
    SAMSHR1132_06430
    MSSA476:
    SAS0663
    Mu3:
    SAHV_0695
    Mu50:
    SAV0698
    MW2:
    MW0660
    RF122:
    SAB0647
    ST398:
    SAPIG0775
    T0131:
    SAT0131_00768 (sep)
    TCH60:
    HMPREF0772_12489 (lacR2)
    TW20:
    SATW20_07730
    USA300_TCH1516:
    USA300HOU_0721
    VC40:
    SAVC_03125

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMIITEKRHELILEELLHKDFLTLQELIDRTGCSASTIRRDLSKLQQLGKLQRVHGGAML
    N315            -MIITEKRHELILEELSHKDFLTLQELIDRTGCSASTIRRDLSKLQQLGKLQRVHGGAML
    NCTC8325        MMIITEKRHELILEELSHKDFLTLQELIDRTGCSASTIRRDLSKLQQLGKLQRVHGGAML
    Newman          -MIITEKRHELILEELSHKDFLTLQELIDRTGCSASTIRRDLSKLQQLGKLQRVHGGAML
    USA300_FPR3757  -MIITEKRHELILEELSHKDFLTLQELIDRTGCSASTIRRDLSKLQQLGKLQRVHGGAML
                     *************** *******************************************

    COL             KENRMVEANLTEKLATNLDEKKMIAKIAANQINDNECLFIDAGSSTLELIKYIQAKDIIV
    N315            KENRMIEANLTEKLATNLDEKKMIAKIAANQINDNECLFIDAGSSTLELIKYIQAKDIIV
    NCTC8325        KENRMVEANLTEKLATNLDEKKMIAKIAANQINDNECLFIDAGSSTLELIKYIQAKDIIV
    Newman          KENRMVEANLTEKLATNLDEKKMIAKIAANQINDNECLFIDAGSSTLELIKYIQAKDIIV
    USA300_FPR3757  KENRMVEANLTEKLATNLDEKKMIAKIAANQINDNECLFIDAGSSTLELIKYIQAKDIIV
                    *****:******************************************************

    COL             VTNGLTHVEALLKKGIKTIMLGGQVKENTLATIGSSAMEILRRYCFDKAFIGMNGLDIEL
    N315            VTNGLTHVEALLKKGIKTIMLGGQVKENTLATIGSSAMEILRRYCFDKAFIGMNGLDIEL
    NCTC8325        VTNGLTHVEALLKKGIKTIMLGGQVKENTLATIGSSAMEILRRYCFDKAFIGMNGLDIEL
    Newman          VTNGLTHVEALLKKGIKTIMLGGQVKENTLATIGSSAMEILRRYCFDKAFIGMNGLDIEL
    USA300_FPR3757  VTNGLTHVEALLKKGIKTIMLGGQVKENTLATIGSSAMEILRRYCFDKAFIGMNGLDIEL
                    ************************************************************

    COL             GLTTPDEQEALVKQTAMSLANQSFVLIDHSKFNKVYFARVPLLESTTIITSEKALNQESL
    N315            GLTTPDEQEALVKQTAMSLANQSFVLIDHSKFNKVYFARVPLLESTTIITSEKALNQESL
    NCTC8325        GLTTPDEQEALVKQTAMSLANQSFVLIDHSKFNKVYFARVPLLESTTIITSEKALNQESL
    Newman          GLTTPDEQEALVKQTAMSLANQSFVLIDHSKFNKVYFARVPLLESTTIITSEKALNQESL
    USA300_FPR3757  GLTTPDEQEALVKQTAMSLANQSFVLIDHSKFNKVYFARVPLLESTTIITSEKALNQESL
                    ************************************************************

    COL             KEYQQKYHFIGGTL
    N315            KEYQQKYHFIGGTL
    NCTC8325        KEYQQKYHFIGGTL
    Newman          KEYQQKYHFIGGTL
    USA300_FPR3757  KEYQQKYHFIGGTL
                    **************