From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002588000
  • symbol?:
  • description?: aldo/keto reductase

      descriptions from strain specific annotations:

    • aldo/keto reductase
    • aldo/keto reductase oxidoreductase
    • aldo/keto reductase family protein
    • aldo/keto reductase family oxidoreductase
    • 2,5-diketo-D-gluconic acid reductase A (2,5-DKGreductase A) (2,5-DKGR A) (25DKGR-A) (AKR5C)
    • oxidoreductase of aldo/keto reductase family, subgroup 1
    • 2,5-didehydrogluconate reductase
    • 2,5-diketo-D-gluconate reductase
    • dehydrogenase
    • glyoxal reductase
    • oxidoreductase
    • oxidoreductase, aldo/keto reductase family
  • strand?: +
  • coordinates?: 3101065..3101904
  • synteny block?: BlockID0018240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0680
    08BA02176:
    C248_0787
    11819-97:
    MS7_0754 (yvgN)
    71193:
    ST398NM01_0780
    ECT-R 2:
    ECTR2_654
    ED133:
    SAOV_0737
    ED98:
    SAAV_0665
    HO 5096 0412:
    SAEMRSA15_06290
    JH1:
    SaurJH1_0743
    JH9:
    SaurJH9_0727
    JKD6008:
    SAA6008_00719
    JKD6159:
    SAA6159_00658
    LGA251:
    SARLGA251_06360
    M013:
    M013TW_0689
    MRSA252:
    SAR0756
    MSHR1132:
    SAMSHR1132_06480
    MSSA476:
    SAS0668
    Mu3:
    SAHV_0700
    Mu50:
    SAV0703
    MW2:
    MW0665
    RF122:
    SAB0652
    ST398:
    SAPIG0780
    T0131:
    SAT0131_00773
    TCH60:
    HMPREF0772_12484 (dkgB2)
    TW20:
    SATW20_07780
    USA300_TCH1516:
    USA300HOU_0726
    VC40:
    SAVC_03150

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLNEIQILNNGYPMPSVGLGVYKISDEDMTKVVNAAIDAGYRAFDTAYFYDNEASLGRAL
    N315            MLNEIQILNNGYPMPSVGLGVYKISDEDMTKVVNAAIDAGYRAFDTAYFYDNEASLGRAL
    NCTC8325        MLNEIQILNNGYPMPSVGLGVYKISDEDMTKVVNAAIDAGYRAFDTAYFYDNEASLGRAL
    Newman          MLNEIQILNNGYPMPSVGLGVYKISDEDMTKVVNAAIDAGYRAFDTAYFYDNEASLGRAL
    USA300_FPR3757  MLNEIQILNNGYPMPSVGLGVYKISDEDMTKVVNAAIDAGYRAFDTAYFYDNEASLGRAL
                    ************************************************************

    COL             KDNGVDREDLFITTKLWNDYQGYEKTFEYFNKSIENLQTDYLDLFLIHWPCEADGLFLET
    N315            KDNGVDREDLFITTKLWNDYQGYEKTFEYFNKSIENLQTDYLDLFLIHWPCEADGLFLET
    NCTC8325        KDNGVDREDLFITTKLWNDYQGYEKTFEYFNKSIENLQTDYLDLFLIHWPCEADGLFLET
    Newman          KDNGVDREDLFITTKLWNDYQGYEKTFEYFNKSIENLQTDYLDLFLIHWPCEADGLFLET
    USA300_FPR3757  KDNGVDREDLFITTKLWNDYQGYEKTFEYFNKSIENLQTDYLDLFLIHWPCEADGLFLET
                    ************************************************************

    COL             YKAMEELYEQGKVKAIGVCNFNVHHLEKLMAQSSIKPMVNQIEVHPYFNQQELQEFCDRH
    N315            YKAMEELYEQGKVKAIGVCNFNVHHLEKLMAQSSIKPMVNQIEVHPYFNQQELQEFCDRH
    NCTC8325        YKAMEELYEQGKVKAIGVCNFNVHHLEKLMAQSSIKPMVNQIEVHPYFNQQELQEFCDRH
    Newman          YKAMEELYEQGKVKAIGVCNFNVHHLEKLMAQSSIKPMVNQIEVHPYFNQQELQEFCDRH
    USA300_FPR3757  YKAMEELYEQGKVKAIGVCNFNVHHLEKLMAQSSIKPMVNQIEVHPYFNQQELQEFCDRH
                    ************************************************************

    COL             DIKVTAWMPLMRNRGLLDDPVIVKIAEKYHKTPAQVVLRWHLAHNRIIIPKSQTPKRIQE
    N315            DIKVTAWMPLMRNRGLLDNPVIVKIAEKYHKTPAQVVLRWHLAHNRIIIPKSQTPKRIQE
    NCTC8325        DIKVTAWMPLMRNRGLLDDPVIVKIAEKYHKTPAQVVLRWHLAHNRIIIPKSQTPKRIQE
    Newman          DIKVTAWMPLMRNRGLLDDPVIVKIAEKYHKTPAQVVLRWHLAHNRIIIPKSQTPKRIQE
    USA300_FPR3757  DIKVTAWMPLMRNRGLLDDPVIVKIAEKYHKTPAQVVLRWHLAHNRIIIPKSQTPKRIQE
                    ******************:*****************************************

    COL             NIDILDFNLELTEVAEIDALNRNARQGKNPDDVKIGDLK
    N315            NIDILDFNLELTEVAEIDALDRNARQGKNPDDVKIGDLK
    NCTC8325        NIDILDFNLELTEVAEIDALNRNARQGKNPDDVKIGDLK
    Newman          NIDILDFNLELTEVAEIDALNRNARQGKNPDDVKIGDLK
    USA300_FPR3757  NIDILDFNLELTEVAEIDALNRNARQGKNPDDVKIGDLK
                    ********************:******************