From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002589000
  • symbol?: csbB
  • description?: CsbB stress response protein

      descriptions from strain specific annotations:

    • CsbB stress response protein
    • glycosyl transferase family protein
    • putative glycosyltransferase csbB
    • glycosyl transferase, group 2 family protein
    • glucosyl transferase
    • glycosyl transferase 2 family protein
    • putative glucosyl transferase
    • undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase
    • group 2 glycosyl transferase
    • bactoprenol glucosyl transferase
    • Undecaprenyl-phosphate beta-N-acetylglucosaminyltransferase
    • bactoprenol glucosyl transferase or stress response regulator
  • strand?: +
  • coordinates?: 3102036..3103043
  • synteny block?: BlockID0018250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0681 (csbB)
    08BA02176:
    C248_0788
    11819-97:
    MS7_0755
    71193:
    ST398NM01_0781
    ECT-R 2:
    ECTR2_655
    ED133:
    SAOV_0738
    ED98:
    SAAV_0666
    HO 5096 0412:
    SAEMRSA15_06300
    JH1:
    SaurJH1_0744
    JH9:
    SaurJH9_0728
    JKD6008:
    SAA6008_00720
    JKD6159:
    SAA6159_00659
    LGA251:
    SARLGA251_06370
    M013:
    M013TW_0690
    MRSA252:
    SAR0757
    MSHR1132:
    SAMSHR1132_06490
    MSSA476:
    SAS0669
    Mu3:
    SAHV_0701
    Mu50:
    SAV0704
    MW2:
    MW0666
    RF122:
    SAB0653
    ST398:
    SAPIG0781
    T0131:
    SAT0131_00774
    TCH60:
    HMPREF0772_12483
    TW20:
    SATW20_07790
    USA300_TCH1516:
    USA300HOU_0727
    VC40:
    SAVC_03155

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIRVVIPCFNEGEVITQTHQQLTEILSQDSSVKGYDYNMLFIDDGSTDTTIDEMQHLAT
    N315            MKIRVVIPCFNEGEVITQTHQQLTEILSQDSSVKGYDYNMLFIDDGSTDTTIDEMQHLAT
    NCTC8325        MKIRVVIPCFNEGEVITQTHQQLTEILSQDSSVKGYDYNMLFIDDGSTDTTIDEMQHLAT
    Newman          MKIRVVIPCFNEGEVITQTHQQLTEILSQDSSVKGYDYNMLFIDDGSTDTTIDEMQHLAT
    USA300_FPR3757  MKIRVVIPCFNEGEVITQTHQQLTEILSQDSSVKGYDYNMLFIDDGSTDTTIDEMQHLAT
                    ************************************************************

    COL             IDRHVSFISFSRNFGKEAAMIAGYQHSTEFDAVIMIDCDLQHPPEYIPKMVEGFMEGYDQ
    N315            IDRHVSFISFSRNFGKEAAMIAGYQHSTEFDAVIMIDCDLQHPPEYIPKMVEGFMEGYDQ
    NCTC8325        IDRHVSFISFSRNFGKEAAMIAGYQHSTEFDAVIMIDCDLQHPPEYIPKMVEGFMEGYDQ
    Newman          IDRHVSFISFSRNFGKEAAMIAGYQHSTEFDAVIMIDCDLQHPPEYIPKMVEGFMEGYDQ
    USA300_FPR3757  IDRHVSFISFSRNFGKEAAMIAGYQHSTEFDAVIMIDCDLQHPPEYIPKMVEGFMEGYDQ
                    ************************************************************

    COL             VIAKRDRSGENFSRKTLSHLYYKLVNCFVEEVQFDDGVGDFRLLSQRAVKSIASLEEYNR
    N315            VIAKRDRSGENFSRKTLSHLYYKLVNCFVEEVQFDDGVGDFRLLSQRAVKSIASLEEYNR
    NCTC8325        VIAKRDRSGENFSRKTLSHLYYKLVNCFVEEVQFDDGVGDFRLLSQRAVKSIASLEEYNR
    Newman          VIAKRDRSGENFSRKTLSHLYYKLVNCFVEEVQFDDGVGDFRLLSQRAVKSIASLEEYNR
    USA300_FPR3757  VIAKRDRSGENFSRKTLSHLYYKLVNCFVEEVQFDDGVGDFRLLSQRAVKSIASLEEYNR
                    ************************************************************

    COL             FSKGLFEWIGYNTKVFTYQNVERQKGESKWSFKKLFNYGIDGLISFNSKPLRMMIYLGLF
    N315            FSKGLFEWIGYNTKVFTYQNVERQKGESKWSFKKLFNYGIDGLISFNSKPLRMMIYLGLF
    NCTC8325        FSKGLFEWIGYNTKVFTYQNVERQKGESKWSFKKLFNYGIDGLISFNSKPLRMMIYLGLF
    Newman          FSKGLFEWIGYNTKVFTYQNVERQKGESKWSFKKLFNYGIDGLISFNSKPLRMMIYLGLF
    USA300_FPR3757  FSKGLFEWIGYNTKVFTYQNVERQKGESKWSFKKLFNYGIDGLISFNSKPLRMMIYLGLF
                    ************************************************************

    COL             IFSISVLYIIYLFINIMISGVNIPGYFSTIAAILLLGGIQLISIGVVGEYIGRIYYEVKA
    N315            IFSISALYIIYLFINIMISGVNIPGYFSTIAAILLLGGIQLISIGVVGEYIGRIYYEVKA
    NCTC8325        IFSISVLYIIYLFINIMISGVNIPGYFSTIAAILLLGGIQLISIGVVGEYIGRIYYEVKA
    Newman          IFSISVLYIIYLFINIMISGVNIPGYFSTIAAILLLGGIQLISIGVVGEYIGRIYYEVKA
    USA300_FPR3757  IFSISVLYIIYLFINIMISGVNIPGYFSTIAAILLLGGIQLISIGVVGEYIGRIYYEVKA
                    *****.******************************************************

    COL             RPKYIIQATNLSSLENDEKDTHKVYSK
    N315            RPKYIIQATNLSSIENDEKDTHKVYSK
    NCTC8325        RPKYIIQATNLSSLENDEKDTHKVYSK
    Newman          RPKYIIQATNLSSLENDEKDTHKVYSK
    USA300_FPR3757  RPKYIIQATNLSSLENDEKDTHKVYSK
                    *************:*************