From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002590000
  • symbol?: saeS
  • description?: histidine protein kinase

      descriptions from strain specific annotations:

    • histidine protein kinase
    • histidine kinase
    • integral membrane sensor signal transduction histidine kinase
    • ATPase
    • sensor histidine kinase SaeS
    • Sensor histidine protein kinase SaeS (exoprotein expression protein S)
    • histidine protein kinase saeS
    • histidine kinase protein
    • histidine kinase protein SaeS
    • two component system histidine kinase
  • strand?: -
  • coordinates?: 3103118..3104173
  • synteny block?: BlockID0018260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0765 (saeS)
    N315:
    SA0660 (saeS)
    NCTC8325:
    Newman:
    NWMN_0674 (saeS)
    USA300_FPR3757:
    04-02981:
    SA2981_0682 (saeS)
    08BA02176:
    C248_0789 (saeS)
    11819-97:
    MS7_0756 (saeS)
    71193:
    ST398NM01_0782
    ECT-R 2:
    ECTR2_656
    ED133:
    SAOV_0739c (saeS)
    ED98:
    SAAV_0667 (saeS)
    HO 5096 0412:
    SAEMRSA15_06310 (saeS)
    JH1:
    SaurJH1_0745
    JH9:
    SaurJH9_0729
    JKD6008:
    SAA6008_00721 (saeS)
    JKD6159:
    SAA6159_00660 (saeS)
    LGA251:
    SARLGA251_06380 (saeS)
    M013:
    M013TW_0691
    MRSA252:
    SAR0758 (saeS)
    MSHR1132:
    SAMSHR1132_06500
    MSSA476:
    SAS0670
    Mu3:
    SAHV_0702 (saeS)
    Mu50:
    SAV0705 (saeS)
    MW2:
    MW0667 (saeS)
    RF122:
    SAB0654c (saeS)
    ST398:
    SAPIG0782
    T0131:
    SAT0131_00775
    TCH60:
    HMPREF0772_12482 (saeS)
    TW20:
    SATW20_07800 (saeS)
    USA300_TCH1516:
    USA300HOU_0728 (saeS)
    VC40:
    SAVC_03160

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVLSIRSQIIIGVVSSILLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI
    N315            MVLSIRSQIIIGVVSSILLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI
    NCTC8325        MVLSIRSQIIIGVVSSILLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI
    Newman          MVLSIRSQIIIGVVSSIPLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI
    USA300_FPR3757  MVLSIRSQIIIGVVSSILLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI
                    ***************** ******************************************

    COL             NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ
    N315            NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ
    NCTC8325        NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ
    Newman          NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ
    USA300_FPR3757  NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ
                    ************************************************************

    COL             QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM
    N315            QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM
    NCTC8325        QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM
    Newman          QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM
    USA300_FPR3757  QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM
                    ************************************************************

    COL             THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCNEIDAFYQYRTPLE
    N315            THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRTPLE
    NCTC8325        THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCNEIDAFYQYRTPLE
    Newman          THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCNEIDAFYQYRTPLE
    USA300_FPR3757  THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCNEIDAFYQYRTPLE
                    **********************************************.*************

    COL             RILTNLLDNALKFSNVGSRIDINISENEDQDTIDIAISDEGIGIIPELQERIFERTFRVE
    N315            RILTNLLDNALKFSNVGSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFRVE
    NCTC8325        RILTNLLDNALKFSNVGSRIDINISENEDQDTIDIAISDEGIGIIPELQERIFERTFRVE
    Newman          RILTNLLDNALKFSNVGSRIDINISENEDQDTIDIAISDEGIGIIPELQERIFERTFRVE
    USA300_FPR3757  RILTNLLDNALKFSNVGSRIDINISENEDQDTIDIAISDEGIGIIPELQERIFERTFRVE
                    ***************************:********************************

    COL             NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS
    N315            NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS
    NCTC8325        NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS
    Newman          NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS
    USA300_FPR3757  NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS
                    ***************************************************