From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002591000
  • symbol?: saeR
  • description?: response regulator

      descriptions from strain specific annotations:

    • response regulator
    • DNA-binding response regulator SaeR
    • response regulator protein
    • two component transcriptional regulator
    • response regulator receiver
    • Response regulator SaeR
    • winged helix family two component transcriptional regulator
  • strand?: -
  • coordinates?: 3104173..3104841
  • synteny block?: BlockID0018270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0766 (saeR)
    N315:
    SA0661 (saeR)
    NCTC8325:
    Newman:
    NWMN_0675 (saeR)
    USA300_FPR3757:
    04-02981:
    SA2981_0683 (saeR)
    08BA02176:
    C248_0790 (saeR)
    11819-97:
    MS7_0757 (saeR)
    71193:
    ST398NM01_0783
    ECT-R 2:
    ECTR2_657
    ED133:
    SAOV_0740c (saeR)
    ED98:
    SAAV_0668 (saeR)
    HO 5096 0412:
    SAEMRSA15_06320 (saeR)
    JH1:
    SaurJH1_0746
    JH9:
    SaurJH9_0730
    JKD6008:
    SAA6008_00722 (saeR)
    JKD6159:
    SAA6159_00661 (saeR)
    LGA251:
    SARLGA251_06390 (saeR)
    M013:
    M013TW_0692
    MRSA252:
    SAR0759 (saeR)
    MSHR1132:
    SAMSHR1132_06510
    MSSA476:
    SAS0671
    Mu3:
    SAHV_0703 (saeR)
    Mu50:
    SAV0706 (saeR)
    MW2:
    MW0668 (saeR)
    RF122:
    SAB0655c (saeR)
    ST398:
    SAPIG0783
    T0131:
    SAT0131_00776
    TCH60:
    HMPREF0772_12481 (saeR)
    TW20:
    SATW20_07810 (saeR)
    USA300_TCH1516:
    USA300HOU_0729 (saeR)
    VC40:
    SAVC_03165

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDIDIMVLDIMMPEVNGY
    N315            MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDIDIMVLDIMMPEVNGY
    NCTC8325        MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDIDIMVLDIMMPEVNGY
    Newman          MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDIDIMVLDIMMPEVNGY
    USA300_FPR3757  MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDIDIMVLDIMMPEVNGY
                    ************************************************************

    COL             DIVKEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMK
    N315            DIVKEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMK
    NCTC8325        DIVKEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMK
    Newman          DIVKEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMK
    USA300_FPR3757  DIVKEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFSPRELVLRINNLLTRMK
                    ************************************************************

    COL             KYHHQPVEQLSFDELTLINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEK
    N315            KYHHQPVEQLSFDELTLINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEK
    NCTC8325        KYHHQPVEQLSFDELTLINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEK
    Newman          KYHHQPVEQLSFDELTLINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEK
    USA300_FPR3757  KYHHQPVEQLSFDELTLINLSKVVTVNGHEVPMRIKEFELLWYLASRENEVISKSELLEK
                    ************************************************************

    COL             VWGYDYYEDANTVNVHIHRIREKLEKESFTTYTITTVWGLGYKFERSR
    N315            VWGYDYYEDANTVNVHIHRIREKLEKESFTTYTITTVWGLGYKFERSR
    NCTC8325        VWGYDYYEDANTVNVHIHRIREKLEKESFTTYTITTVWGLGYKFERSR
    Newman          VWGYDYYEDANTVNVHIHRIREKLEKESFTTYTITTVWGLGYKFERSR
    USA300_FPR3757  VWGYDYYEDANTVNVHIHRIREKLEKESFTTYTITTVWGLGYKFERSR
                    ************************************************