From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002594000
  • symbol?: saeP
  • description?: electron transfer DM13 family protein

      descriptions from strain specific annotations:

    • electron transfer DM13 family protein
    • lipoprotein, putative
    • putative lipoprotein
  • strand?: -
  • coordinates?: 3105660..3106100
  • synteny block?: BlockID0018300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0685
    08BA02176:
    C248_0792
    11819-97:
    MS7_0759
    71193:
    ST398NM01_0785
    ECT-R 2:
    ECTR2_659
    ED133:
    SAOV_0742c
    ED98:
    SAAV_0670
    HO 5096 0412:
    SAEMRSA15_06340
    JH1:
    SaurJH1_0748
    JH9:
    SaurJH9_0732
    JKD6008:
    SAA6008_00724
    JKD6159:
    SAA6159_00663
    LGA251:
    SARLGA251_06410 (saeP)
    M013:
    M013TW_0694
    MRSA252:
    SAR0761
    MSHR1132:
    SAMSHR1132_06530
    MSSA476:
    SAS0673
    Mu3:
    SAHV_0705
    Mu50:
    SAV0708
    MW2:
    MW0670
    RF122:
    SAB0657c
    ST398:
    SAPIG0785
    T0131:
    SAT0131_00778
    TCH60:
    HMPREF0772_12479
    TW20:
    SATW20_07830 (saeP)
    USA300_TCH1516:
    USA300HOU_0731
    VC40:
    SAVC_03175

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNTKYFLAAGAVITTLALGACGNSNSQDQGNKTEQKTKSEDSNVKTDKTKHLTGTFSSKN
    N315            MNTKYFLAVGAVASVLTLGACGNSNSQDQGNKTEQKTKSEDSNVKTDKTKHLTGTFSSKN
    NCTC8325        MNTKYFLAAGAVITTLALGACGNSNSQDQGNKTEQKTKSEDSNVKTDKTKHLTGTFSSKN
    Newman          MNTKYFLAAGAVITTLALGACGNSNSQDQGNKTEQKTKSEDSNVKTDKTKHLTGTFSSKN
    USA300_FPR3757  MNTKYFLAAGAVITTLALGACGNSNSQDQGNKTEQKTKSEDSNVKTDKTKHLTGTFSSKN
                    ********.*** :.*:*******************************************

    COL             GETVEGKAEIKNGKLMLTNYKSSKGPDLYVYLTKNGDIKNGKEIAMVDYDKEKQTFDLKN
    N315            GETVEGKAEIKNGKLMLTNYKSSKGPDLYVYLTKNGDIKNGKEIAMVDYDKEKQTFDLKN
    NCTC8325        GETVEGKAEIKNGKLMLTNYKSSKGPDLYVYLTKNGDIKNGKEIAMVDYDKEKQTFDLKN
    Newman          GETVEGKAEIKNGKLMLTNYKSSKGPDLYVYLTKNGDIKNGKEIAMVDYDKEKQTFDLKN
    USA300_FPR3757  GETVEGKAEIKNGKLMLTNYKSSKGPDLYVYLTKNGDIKNGKEIAMVDYDKEKQTFDLKN
                    ************************************************************

    COL             VDLSKYDEVTIYCKKAHVIFGGAKLK
    N315            VDLSKYDEVTIYCKKAHVIFGGAKLK
    NCTC8325        VDLSKYDEVTIYCKKAHVIFGGAKLK
    Newman          VDLSKYDEVTIYCKKAHVIFGGAKLK
    USA300_FPR3757  VDLSKYDEVTIYCKKAHVIFGGAKLK
                    **************************