From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002595000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 3106453..3107037
  • synteny block?: BlockID0018310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0686
    08BA02176:
    C248_0793
    11819-97:
    MS7_0760
    71193:
    ST398NM01_0786
    ECT-R 2:
    ECTR2_660
    ED133:
    SAOV_0743c
    ED98:
    SAAV_0671
    HO 5096 0412:
    SAEMRSA15_06350
    JH1:
    SaurJH1_0749
    JH9:
    SaurJH9_0733
    JKD6008:
    SAA6008_00725
    JKD6159:
    SAA6159_00664
    LGA251:
    SARLGA251_06420
    M013:
    M013TW_0695
    MRSA252:
    SAR0762
    MSHR1132:
    SAMSHR1132_06540
    MSSA476:
    SAS0674
    Mu3:
    SAHV_0706
    Mu50:
    SAV0709
    MW2:
    MW0671
    RF122:
    SAB0658c
    ST398:
    SAPIG0786
    T0131:
    SAT0131_00779
    TCH60:
    HMPREF0772_12478
    TW20:
    SATW20_07840
    USA300_TCH1516:
    USA300HOU_0732
    VC40:
    SAVC_03180

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIVYILINIAIVVLITGFNLYRHQMQHLSLSAMLLSITINAFINTFIIDKYNFITLCTIT
    N315            MILYILINIAIVVLITGFNLYRHQMQHLSLSAMLLSITINAFINTFIIDKYNFITLCTIT
    NCTC8325        MIVYILINIAIVVLITGFNLYRHQMQHLSLSAMLLSITINAFINTFIIDKYNFITLCTIT
    Newman          MIVYILINIAIVVLITGFNLYRHQMQHLSLSAMLLSITINAFINTFIIDKYNFITLCTIT
    USA300_FPR3757  MIVYILINIAIVVLITGFNLYRHQMQHLSLSAMLLSITINAFINTFIIDKYNFITLCTIT
                    **:*********************************************************

    COL             MFIIWTILQFYIDKKLKPVYITDQKFIAIILTIVVSLTQRVTDFSSTQSIYMSIPFLAPA
    N315            MFIIWTILQFYIDKKLKPVYITDQKFIAIILTIVVSLTQRVTDFSSTQSIYMSIPFLAPA
    NCTC8325        MFIIWTILQFYIDKKLKPVYITDQKFIAIILTIVVSLTQRVTDFSSTQSIYMSIPFLAPA
    Newman          MFIIWTILQFYIDKKLKPVYITDQKFIAIILTIVVSLTQRVTDFSSTQSIYMSIPFLAPA
    USA300_FPR3757  MFIIWTILQFYIDKKLKPVYITDQKFIAIILTIVVSLTQRVTDFSSTQSIYMSIPFLAPA
                    ************************************************************

    COL             IFIIGGIMLFISTFNSLDETAENNNKIKKLMIKGLIIINISFIVMMVLTPYWYLYLIVYL
    N315            IFIIGGIMLFISTFNSLDETAENNNKIKKLMIKGLIIINISFIVMMVLTPYWYLYLIVYL
    NCTC8325        IFIIGGIMLFISTFNSLDETAENNNKIKKLMIKGLIIINISFIVMMVLTPYWYLYLIVYL
    Newman          IFIIGGIMLFISTFNSLDETAENNNKIKKLMIKGLIIINISFIVMMVLTPYWYLYLIVYL
    USA300_FPR3757  IFIIGGIMLFISTFNSLDETAENNNKIKKLMIKGLIIINISFIVMMVLTPYWYLYLIVYL
                    ************************************************************

    COL             IFLLFLLWQKVYKF
    N315            IFLLFLLWQKVYKF
    NCTC8325        IFLLFLLWQKVYKF
    Newman          IFLLFLLWQKVYKF
    USA300_FPR3757  IFLLFLLWQKVYKF
                    **************