From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002596000
  • symbol?: queE
  • description?: 7-carboxy-7-deazaguanine synthase QueE

      descriptions from strain specific annotations:

    • 7-carboxy-7-deazaguanine synthase QueE
    • radical activating enzyme family protein
    • 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE
    • 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein
    • 7-cyano-7-deazaguanosine biosynthesis protein QueE
    • coenzyme PQQ synthesis homologue
    • coenzyme PQQ synthesis-like protein
    • organic radical-activating protein
    • putative radical activating enzyme
    • Queuosine Biosynthesis QueE Radical SAM
    • queuosine biosynthesis radical SAM protein QueE
    • radical activating enzyme
    • radical SAM domain-containing protein
    • radical SAM protein
  • strand?: -
  • coordinates?: 3107136..3107849
  • synteny block?: BlockID0018320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0687 (queE)
    08BA02176:
    C248_0794
    11819-97:
    MS7_0761 (queE)
    71193:
    ST398NM01_0787
    ECT-R 2:
    ECTR2_661 (queE)
    ED133:
    SAOV_0744c
    ED98:
    SAAV_0672
    HO 5096 0412:
    SAEMRSA15_06360
    JH1:
    SaurJH1_0750
    JH9:
    SaurJH9_0734
    JKD6008:
    SAA6008_00726 (queE)
    JKD6159:
    SAA6159_00665 (queE)
    LGA251:
    SARLGA251_06430
    M013:
    M013TW_0696
    MRSA252:
    SAR0763
    MSHR1132:
    SAMSHR1132_06550
    MSSA476:
    SAS0675
    Mu3:
    SAHV_0707
    Mu50:
    SAV0710
    MW2:
    MW0672
    RF122:
    SAB0659c
    ST398:
    SAPIG0787 (queE)
    T0131:
    SAT0131_00780 (ldh1)
    TCH60:
    HMPREF0772_12477 (queE)
    TW20:
    SATW20_07850
    USA300_TCH1516:
    USA300HOU_0733 (exsD)
    VC40:
    SAVC_03185

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKIPVLEIFGPTIQGEGRVIGRKTMFVRTAGCDYRCSWCDSAFTWDGSAKGDIKLMTAE
    N315            MAKIPVLEIFGPTIQGEGRVIGRKTMFVRTAGCDYRCSWCDSAFTWDGSAKGDIKLMTAE
    NCTC8325        MAKIPVLEIFGPTIQGEGRVIGRKTMFVRTAGCDYRCSWCDSAFTWDGSAKGDIKLMTAE
    Newman          MAKIPVLEIFGPTIQGEGRVIGRKTMFVRTAGCDYRCSWCDSAFTWDGSAKGDIKLMTAE
    USA300_FPR3757  MAKIPVLEIFGPTIQGEGRVIGRKTMFVRTAGCDYRCSWCDSAFTWDGSAKGDIKLMTAE
                    ************************************************************

    COL             EIYDELKRIGGDLFNHVTISGGNPALIKGIQELVDLFQDKGIFSALETQGSKFQPWMTQI
    N315            EIYDELKRIGGDLFNHVTISGGNPALIKGIQELVDLFQDKGIFSALETQGSKFQPWMTQI
    NCTC8325        EIYDELKRIGGDLFNHVTISGGNPALIKGIQELVDLFQDKGIFSALETQGSKFQPWMTQI
    Newman          EIYDELKRIGGDLFNHVTISGGNPALIKGIQELVDLFQDKGIFSALETQGSKFQPWMTQI
    USA300_FPR3757  EIYDELKRIGGDLFNHVTISGGNPALIKGIQELVDLFQDKGIFSALETQGSKFQPWMTQI
                    ************************************************************

    COL             DDLTISPKPPSSTMTPDLKKLDEVITQCVPSSLNLKVVVFDDKDYDFAKMIHHRYPDIPF
    N315            DDLTISPKPPSSTMTPDLKKLDEVITQCVPSSLNLKVVVFDDKDYDFAKMIHHRYPDIPF
    NCTC8325        DDLTISPKPPSSTMTPDLKKLDEVITQCVPSSLNLKVVVFDDKDYDFAKMIHHRYPDIPF
    Newman          DDLTISPKPPSSTMTPDLKKLDEVITQCVPSSLNLKVVVFDDKDYDFAKMIHHRYPDIPF
    USA300_FPR3757  DDLTISPKPPSSTMTPDLKKLDEVITQCVPSSLNLKVVVFDDKDYDFAKMIHHRYPDIPF
                    ************************************************************

    COL             YLQVGNPYLSDSVDNHTEKLLERYEQLVDLVMQSNDMNHVYVLPQLHTLLWSNKKGV
    N315            YLQVGNPYLSDSVDNHTEKLLERYEQLVDLVMQSNDMNHVYVLPQLHTLLWSNKKGV
    NCTC8325        YLQVGNPYLSDSVDNHTEKLLERYEQLVDLVMQSNDMNHVYVLPQLHTLLWSNKKGV
    Newman          YLQVGNPYLSDSVDNHTEKLLERYEQLVDLVMQSNDMNHVYVLPQLHTLLWSNKKGV
    USA300_FPR3757  YLQVGNPYLSDSVDNHTEKLLERYEQLVDLVMQSNDMNHVYVLPQLHTLLWSNKKGV
                    *********************************************************