From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002599000
  • symbol?: pabA
  • description?: aminodeoxychorismate/anthranilate synthase component II

      descriptions from strain specific annotations:

    • aminodeoxychorismate/anthranilate synthase component II
    • para-aminobenzoate synthase, glutamine amidotransferase, component II
    • para-aminobenzoate synthase glutamine amidotransferase component II
    • para-aminobenzoate synthase component II
    • Aminodeoxychorismate synthase, glutamine amidotransferase subunit
    • anthranilate/para-aminobenzoate synthase component II
    • glutamine amidotransferase class-I protein
    • glutamine amidotransferase of anthranilate synthase
    • glutamine amidotransferase of anthranilate synthase/aminodeoxychorismate synthase family protein
    • Para-aminobenzoate synthase , amidotransferase component
    • Para-aminobenzoate synthase, amidotransferase component PabAb
    • para-aminobenzoate synthase glutamine amidotransferase component II (ADC synthase)
  • strand?: +
  • coordinates?: 3109298..3109891
  • synteny block?: BlockID0018350
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0773 (pabA)
    N315:
    NCTC8325:
    Newman:
    NWMN_0682 (pabA)
    USA300_FPR3757:
    04-02981:
    SA2981_0690
    08BA02176:
    C248_0797
    11819-97:
    MS7_0764
    71193:
    ST398NM01_0790
    ECT-R 2:
    ECTR2_664
    ED133:
    SAOV_0747
    ED98:
    SAAV_0675 (pabA)
    HO 5096 0412:
    SAEMRSA15_06390
    JH1:
    SaurJH1_0753
    JH9:
    SaurJH9_0737
    JKD6008:
    SAA6008_00729 (pabA)
    JKD6159:
    SAA6159_00668 (pabA)
    LGA251:
    SARLGA251_06460
    M013:
    M013TW_0699
    MRSA252:
    SAR0766
    MSHR1132:
    SAMSHR1132_06580
    MSSA476:
    SAS0678
    Mu3:
    SAHV_0710
    Mu50:
    SAV0713
    MW2:
    MW0675
    RF122:
    SAB0662
    ST398:
    SAPIG0790
    T0131:
    SAT0131_00783
    TCH60:
    HMPREF0772_12474 (pabA)
    TW20:
    SATW20_07880
    USA300_TCH1516:
    USA300HOU_0736 (pabA)
    VC40:
    SAVC_03200

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MILVIDNNDSFTYNLIDYIKTQTKLTVQVVGIDNLLIEDVINMKPKAIVISPGPGNPDDY
    N315            MILVIDNNDSFTYNLIDYIKTQTKLTVQVVGIDNLLIEDVINMKPKAIVISPGPGNPDDY
    NCTC8325        MILVIDNNDSFTYNLIDYIKTQTKLTVQVVGIDNLLIEDVINMKPKAIVISPGPGNPDDY
    Newman          MILVIDNNDSFTYNLIDYIKTQTKLTVQVVGIDNLLIEDVINMKPKAIVISPGPGNPDDY
    USA300_FPR3757  MILVIDNNDSFTYNLIDYIKTQTKLTVQVVGIDNLLIEDVINMKPKAIVISPGPGNPDDY
                    ************************************************************

    COL             PILNEVLEQFYQRVPILGVCLGFQCIVSYFGGNIIHGYHPVHGHTTQLRHTNEGIFQGLP
    N315            PILNEVLEQFYQRVPILGVCLGFQCIVSYFGGNIIHGYHPVHGHTTQLRHTNEGIFQGLP
    NCTC8325        PILNEVLEQFYQRVPILGVCLGFQCIVSYFGGNIIHGYHPVHGHTTQLRHTNEGIFQGLP
    Newman          PILNEVLEQFYQRVPILGVCLGFQCIVSYFGGNIIHGYHPVHGHTTQLRHTNEGIFQGLP
    USA300_FPR3757  PILNEVLEQFYQRVPILGVCLGFQCIVSYFGGNIIHGYHPVHGHTTQLRHTNEGIFQGLP
                    ************************************************************

    COL             QNFNVMRYHSLIADGATFPNCLKITAKNDEAIIMAFEHIRFPVFGVQYHPESILSEYGYR
    N315            QNFNVMRYHSLIADGATFPNCLKITAKNDEAIIMAFEHIRFPVFGVQYHPESILSEYGYR
    NCTC8325        QNFNVMRYHSLIADGATFPNCLKITAKNDEAIIMAFEHIRFPVFGVQYHPESILSEYGYR
    Newman          QNFNVMRYHSLIADGATFPNCLKITAKNDEAIIMAFEHIRFPVFGVQYHPESILSEYGYR
    USA300_FPR3757  QNFNVMRYHSLIADGATFPNCLKITAKNDEAIIMAFEHIRFPVFGVQYHPESILSEYGYR
                    ************************************************************

    COL             QVELFLSKVGDYCENRI
    N315            QVELFLSKVGDYCENRI
    NCTC8325        QVELFLSKVGDYCENRI
    Newman          QVELFLSKVGDYCENRI
    USA300_FPR3757  QVELFLSKVGDYCENRI
                    *****************