From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002600000
  • symbol?: pabB
  • description?: para-aminobenzoate synthase component I

      descriptions from strain specific annotations:

    • para-aminobenzoate synthase component I
    • anthranilate synthase component I/chorismate-binding protein
    • putative para-aminobenzoate synthase component
    • Para-aminobenzoate synthase, aminase component PabAa
    • chorismate binding enzyme family protein
    • pseudogene
    • chorismate-binding domain-containing protein
    • anthranilate/para-aminobenzoate synthase component I
    • para-aminobenzoate synthetase component I
    • aminodeoxychorismate synthase, component I
    • Para-aminobenzoate synthase , aminase component
  • strand?: +
  • coordinates?: 3109866..3111030
  • synteny block?: BlockID0018360
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0683 (pabB)
    USA300_FPR3757:
    04-02981:
    SA2981_0691
    08BA02176:
    C248_0798
    11819-97:
    MS7_0765 (pabB)
    71193:
    ST398NM01_0791
    ECT-R 2:
    ECTR2_665
    ED133:
    SAOV_0748
    ED98:
    SAAV_0676
    HO 5096 0412:
    SAEMRSA15_06400
    JH1:
    SaurJH1_0754
    JH9:
    SaurJH9_0738
    JKD6008:
    SAA6008_00730 (pabB)
    JKD6159:
    SAA6159_00669 (pabB)
    LGA251:
    SARLGA251_06470
    M013:
    M013TW_0700
    MRSA252:
    SAR0767
    MSHR1132:
    SAMSHR1132_06590
    MSSA476:
    SAS0679
    Mu3:
    SAHV_0711
    Mu50:
    SAV0714
    MW2:
    MW0676
    RF122:
    SAB0663
    ST398:
    SAPIG0791
    T0131:
    SAT0131_00784
    TCH60:
    HMPREF0772_12473 (pabB)
    TW20:
    SATW20_07890
    USA300_TCH1516:
    USA300HOU_0737 (pabB)
    VC40:
    SAVC_03205

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MRIEYNYRYYLTENEYKQYHIQLKGFIKKYVATKLADVGEVIHFAQAQQRQGRYVSLYLS
    NCTC8325        MRIEYNYRYYLTENEYKQYHIQLKGFIKKYVATKLADVGEVIHFAQAQQRQGRYVSLYLS
    Newman          MRIEYNYRYYLTENEYKQYHIQLKGFIKKYVATKLADVGEVIHFAQAQQRQGRYVSLYLS
    USA300_FPR3757  MRIEYNYRYYLTENEYKQYHIQLKGFIKKYVATKLADVGEVIHFAQAQQRQGRYVSLYLS
                    ************************************************************

    N315            YEAAKYFNHVMCTHSLAKDDIYAVAYSFEKAESINSTYEHQTSYVSKHHFSFVESSEVMM
    NCTC8325        YEAAKYFNHAMCTHSLAKDDIYAAAYSFEKAESINSTYEHQTSYVSKYHFSFVESSEVMM
    Newman          YEAAKYFNHAMCTHSLAKDDIYAAAYSFEKAESINSTYEHQTSYVSKYHFSFVESSEVMM
    USA300_FPR3757  YEAAKYFNHAMCTHSLAKDDIYAAAYSFEKAESINSTYEHQTSYVSKYHFSFVESSEVMM
                    *********.*************.***********************:************

    N315            TNIKRVQQAIVEGETYQVNYTARLTDNIYYPISTLYERLTQFSNGNYTALLQTDEIQVAS
    NCTC8325        TNIKRVQQAIVEGETYQVNYTARLTDNIYYPISTLYERLTQFSNGNYTALLQTDEIQVAS
    Newman          TNIKRVQQAIVEGETYQVNYTARLTDNIYYPISTLYERLTQFSNGNYTALLQTDEIQVAS
    USA300_FPR3757  TNIKRVQQAIVEGETYQVNYTARLTDNIYYPISTLYERLTQFSNGNYTALLQTDEIQVAS
                    ************************************************************

    N315            ISPELFFQKGQFNNVDNVIISKPMKGTMPRGKTEAEDQQYYKSLQTSSKDRAENVMIVDL
    NCTC8325        ISPELFFQKGQFNNVDNVIISKPMKGTMPRGKTEAEDQQYYKTLQTSSKDRAENVMIVDL
    Newman          ISPELFFQKGQFNNVDNVIISKPMKGTMPRGKTEAEDQQYYKTLQTSSKDRAENVMIVDL
    USA300_FPR3757  ISPELFFQKGQFNNVDNVIISKPMKGTMPRGKTEAEDQQYYKTLQTSSKDRAENVMIVDL
                    ******************************************:*****************

    N315            LRNDIGRISQSGSIKVYKLFFIEAYKTVFQMTSMVSGTLKTNTDLTQILTSLFPCGSITG
    NCTC8325        LRNDIGRISQSGSIKVYKLFFIEAYKTVFQMTSMVSGTLKNNTDLTQILTSLFPCGSITG
    Newman          LRNDIGRISQSGSIKVYKLFFIEAYKTVFQMTSMVSGTLKNNTDLTQILTSLFPCGSITG
    USA300_FPR3757  LRNDIGRISQSGSIKVYKLFFIEAYKTVFQMTSMVSGTLKNNTDLTQILTSLFPCGSITG
                    ****************************************.*******************

    N315            APKLNTMKYIKQFESSPRGIYCGAIGLLLPTEDDKMIFNIPIRTIEYKYGQAIYGVGAGI
    NCTC8325        APKLNTMKYIKQLESSPRGIYCGAIGLLLPTEDDKMIFNIPIRTIEYKYGQAIYGVGAGI
    Newman          APKLNTMKYIKQLESSPRGIYCGAIGLLLPTEDDKMIFNIPIRTIEYKYGQAIYGVGAGI
    USA300_FPR3757  APKLNTMKYIKQLESSPRGIYCGAIGLLLPTEDDKMIFNIPIRTIEYKYGQAIYGVGAGI
                    ************:***********************************************

    N315            TIDSKPKDEVNEFYAKTKILEML
    NCTC8325        TIDSKPKDEVNEFYAKTKILEML
    Newman          TIDSKPKDEVNEFYAKTKILEML
    USA300_FPR3757  TIDSKPKDEVNEFYAKTKILEML
                    ***********************