From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002605000
  • symbol?: ltaS
  • description?: lipoteichoic acid synthase

      descriptions from strain specific annotations:

    • lipoteichoic acid synthase
    • sulfatase
    • sulfatase family protein
    • anion-binding protein
    • Glycerol phosphate lipoteichoic acid synthase
    • Lipoteichoic acid synthase LtaS Type Ib
    • phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
    • phosphoglycerol transferase I
    • Processed glycerol phosphate lipoteichoic acid synthase
    • putative sulfatase
    • transmembrane sulfatase
  • strand?: +
  • coordinates?: 3114132..3116139
  • synteny block?: BlockID0018410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0696
    08BA02176:
    C248_0803
    11819-97:
    MS7_0770 (ltaS)
    71193:
    ST398NM01_0796
    ECT-R 2:
    ECTR2_669
    ED133:
    SAOV_0753
    ED98:
    SAAV_0680
    HO 5096 0412:
    SAEMRSA15_06450
    JH1:
    SaurJH1_0759
    JH9:
    SaurJH9_0742
    JKD6008:
    SAA6008_00734
    JKD6159:
    SAA6159_00673
    LGA251:
    SARLGA251_06520
    M013:
    M013TW_0705
    MRSA252:
    SAR0772
    MSHR1132:
    SAMSHR1132_06640
    MSSA476:
    SAS0684
    Mu3:
    SAHV_0716
    Mu50:
    SAV0719
    MW2:
    MW0681
    RF122:
    SAB0668
    ST398:
    SAPIG0796
    T0131:
    SAT0131_00788
    TCH60:
    HMPREF0772_12468
    TW20:
    SATW20_07940
    USA300_TCH1516:
    USA300HOU_0742
    VC40:
    SAVC_03225

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSSQKKKISLFAFFLLTVITITLKTYFSYYVDFSLGVKGLVQNLILLMNPYSLVALVLSV
    N315            MSSQKKKISLFAFFLLTVITITLKTYFSYYVDFSLGVKGLVQNLILLMNPYSLVALVLSV
    NCTC8325        MSSQKKKISLFAFFLLTVITITLKTYFSYYVDFSLGVKGLVQNLILLMNPYSLVALVLSV
    Newman          MSSQKKKISLFAFFLLTVITITLKTYFSYYVDFSLGVKGLVQNLILLMNPYSLVALVLSV
    USA300_FPR3757  MSSQKKKISLFAFFLLTVITITLKTYFSYYVDFSLGVKGLVQNLILLMNPYSLVALVLSV
                    ************************************************************

    COL             FLFFKGKKAFWFMFIGGFLLTFLLYANVVYFRFFSDFLTFSTLNQVGNVESMGGAVSASF
    N315            FLFFKGKKAFWFMFIGGFLLTFLLYANVVYFRFFSDFLTFSTLNQVGNVESMGGAVSASF
    NCTC8325        FLFFKGKKAFWFMFIGGFLLTFLLYANVVYFRFFSDFLTFSTLNQVGNVESMGGAVSASF
    Newman          FLFFKGKKAFWFMFIGGFLLTFLLYANVVYFRFFSDFLTFSTLNQVGNVESMGGAVSASF
    USA300_FPR3757  FLFFKGKKAFWFMFIGGFLLTFLLYANVVYFRFFSDFLTFSTLNQVGNVESMGGAVSASF
                    ************************************************************

    COL             KWYDFVYFIDTLVYLFILIFKTKWLDTKAFSKKFVPVVMAASVALFFLNLAFAETDRPEL
    N315            KWYDFVYFIDTLVYLFILIFKTKWLDTKAFSKKFVPVVMAASVALFFLNLAFAETDRPEL
    NCTC8325        KWYDFVYFIDTLVYLFILIFKTKWLDTKAFSKKFVPVVMAASVALFFLNLAFAETDRPEL
    Newman          KWYDFVYFIDTLVYLFILIFKTKWLDTKAFSKKFVPVVMAASVALFFLNLAFAETDRPEL
    USA300_FPR3757  KWYDFVYFIDTLVYLFILIFKTKWLDTKAFSKKFVPVVMAASVALFFLNLAFAETDRPEL
                    ************************************************************

    COL             LTRTFDHKYLVKYLGPYNFTVYDGVKTIENNQQKALASEDDLTKVLNYTKQRQTEPNPEY
    N315            LTRTFDHKYLVKYLGPYNFTVYDGVKTIENNQQKALASEDDLTKVLNYTKQRQTEPNPEY
    NCTC8325        LTRTFDHKYLVKYLGPYNFTVYDGVKTIENNQQKALASEDDLTKVLNYTKQRQTEPNPEY
    Newman          LTRTFDHKYLVKYLGPYNFTVYDGVKTIENNQQKALASEDDLTKVLNYTKQRQTEPNPEY
    USA300_FPR3757  LTRTFDHKYLVKYLGPYNFTVYDGVKTIENNQQKALASEDDLTKVLNYTKQRQTEPNPEY
                    ************************************************************

    COL             YGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNKLSSGKEQFTYFPNFFHQTGQGKT
    N315            YGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNKLSSGKEQFTYFPNFFHQTGQGKT
    NCTC8325        YGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNKLSSGKEQFTYFPNFFHQTGQGKT
    Newman          YGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNKLSSGKEQFTYFPNFFHQTGQGKT
    USA300_FPR3757  YGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNKLSSGKEQFTYFPNFFHQTGQGKT
                    ************************************************************

    COL             SDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQKQGYKSDVMHGDYKTFWNRDQVY
    N315            SDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQKQGYKSDVMHGDYKTFWNRDQVY
    NCTC8325        SDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQKQGYKSDVMHGDYKTFWNRDQVY
    Newman          SDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQKQGYKSDVMHGDYKTFWNRDQVY
    USA300_FPR3757  SDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQKQGYKSDVMHGDYKTFWNRDQVY
                    ************************************************************

    COL             KHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSANYQAKMKSPFYSHLITLTNHYPFT
    N315            KHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSANYQAKMKSPFYSHLITLTNHYPFT
    NCTC8325        KHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSANYQAKMKSPFYSHLITLTNHYPFT
    Newman          KHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSANYQAKMKSPFYSHLITLTNHYPFT
    USA300_FPR3757  KHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSANYQAKMKSPFYSHLITLTNHYPFT
                    ************************************************************

    COL             LDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYINDLKKKGLYDNSVIMIYGDHYGIS
    N315            LDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYINDLKKKGLYDNSVIMIYGDHYGIS
    NCTC8325        LDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYINDLKKKGLYDNSVIMIYGDHYGIS
    Newman          LDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYINDLKKKGLYDNSVIMIYGDHYGIS
    USA300_FPR3757  LDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYINDLKKKGLYDNSVIMIYGDHYGIS
                    ************************************************************

    COL             ENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSGGINNEYAGQVDVMPTILHLAGID
    N315            ENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSGGINNEYAGQVDVMPTILHLAGID
    NCTC8325        ENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSGGINNEYAGQVDVMPTILHLAGID
    Newman          ENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSGGINNEYAGQVDVMPTILHLAGID
    USA300_FPR3757  ENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSGGINNEYAGQVDVMPTILHLAGID
                    ************************************************************

    COL             TKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNGKIYSNKNNELITTQPADFEKNKK
    N315            TKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNGKIYSNKNNELITTQPADFEKNKK
    NCTC8325        TKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNGKIYSNKNNELITTQPADFEKNKK
    Newman          TKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNGKIYSNKNNELITTQPADFEKNKK
    USA300_FPR3757  TKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNGKIYSNKNNELITTQPADFEKNKK
                    ************************************************************

    COL             QVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYETGPKANSKK
    N315            QVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYETGPKANSKK
    NCTC8325        QVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYETGPKANSKK
    Newman          QVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYETGPKANSKK
    USA300_FPR3757  QVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYETGPKANSKK
                    **********************************************