From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002610000
  • symbol?: opuBB
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • osmoprotectant ABC transporter permease
    • amino acid ABC transporter permease
    • ABC transporter permease protein
    • ABC-type proline/glycine betaine transport systems, permease component
    • choline ABC transporter permease
    • choline transporter
    • choline transporter, permease protein
    • glycine/betaine ABC transporter permease
    • glycine betaine/carnitine/choline ABC superfamily ATP binding cassette transporter, membrane protein
    • glycine betaine/carnitine/choline ABC transporter membrane protein
    • glycine betaine/carnitine/choline ATP-binding ABC transport protein
    • glycine betaine ABC transporter substrate-binding protein
    • glycine betaine transport system permease
    • osmoprotectant ABC transporter, permease protein
    • OsmotiCALL import_20_25_26_pangenomey activated L-carnitine/choline ABC transporter, permease protein OpuCB
    • substrate binding domain of ABC-type glycine betaine transport system family protein
    • substrate-binding region of ABC-type glycine betaine transport system
  • strand?: +
  • coordinates?: 3121348..3122862
  • synteny block?: BlockID0018460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0783 (opuBB)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0700
    08BA02176:
    C248_0808
    11819-97:
    MS7_0774
    71193:
    ST398NM01_0800
    ECT-R 2:
    ECTR2_673
    ED133:
    SAOV_0757 (opuBB)
    ED98:
    SAAV_0684
    HO 5096 0412:
    SAEMRSA15_06490
    JH1:
    SaurJH1_0763
    JH9:
    SaurJH9_0746
    JKD6008:
    SAA6008_00738
    JKD6159:
    SAA6159_00677
    LGA251:
    SARLGA251_06560
    M013:
    M013TW_0709
    MRSA252:
    SAR0776
    MSHR1132:
    SAMSHR1132_06680
    MSSA476:
    SAS0688
    Mu3:
    SAHV_0720
    Mu50:
    SAV0723
    MW2:
    MW0685
    RF122:
    SAB0672
    ST398:
    SAPIG0800
    T0131:
    SAT0131_00792
    TCH60:
    HMPREF0772_12464 (opuBB)
    TW20:
    SATW20_07980
    USA300_TCH1516:
    USA300HOU_0746
    VC40:
    SAVC_03245

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNFFDILSERKGQLFSTMIEHIQISFIALLIATAIAVPLGILLTKTKTISEIVMNIAAI
    N315            MTNFFDILSERKGQLFSTMIEHIQISFIALLIATAIAVPLGILLTKTKTISEIVMNIAAI
    NCTC8325        MTNFFDILSERKGQLFSTMIEHIQISFIALLIATAIAVPLGILLTKTKTISEIVMNIAAI
    Newman          MTNFFDILSERKGQLFSTMIEHIQISFIALLIATAIAVPLGILLTKTKTISEIVMNIAAI
    USA300_FPR3757  MTNFFDILSERKGQLFSTMIEHIQISFIALLIATAIAVPLGILLTKTKTISEIVMNIAAI
                    ************************************************************

    COL             LQTIPSLALLGLMIPLFGIGRVPAIIALVVYALLPILRNTYTGIKEVDPSLIEAAKGIGM
    N315            LQTIPSLALLGLMIPLFGIGRVPAIIALVVYALLPILRNTYTGIKEVDPSLIEAAKGIGM
    NCTC8325        LQTIPSLALLGLMIPLFGIGRVPAIIALVVYALLPILRNTYTGIKEVDPSLIEAAKGIGM
    Newman          LQTIPSLALLGLMIPLFGIGRVPAIIALVVYALLPILRNTYTGIKEVDPSLIEAAKGIGM
    USA300_FPR3757  LQTIPSLALLGLMIPLFGIGRVPAIIALVVYALLPILRNTYTGIKEVDPSLIEAAKGIGM
                    ************************************************************

    COL             KPFRRLTKVELPIAMPVIMAGVRTAMVLIIGTATLAALIGAGGLGDLILLGIDRNNASLI
    N315            KPFRRLTKVELPIAMPVIMAGVRTAMVLIIGTATLAALIGAGGLGDLILLGIDRNNASLI
    NCTC8325        KPFRRLTKVELPIAMPVIMAGVRTAMVLIIGTATLAALIGAGGLGDLILLGIDRNNASLI
    Newman          KPFRRLTKVELPIAMPVIMAGVRTAMVLIIGTATLAALIGAGGLGDLILLGIDRNNASLI
    USA300_FPR3757  KPFRRLTKVELPIAMPVIMAGVRTAMVLIIGTATLAALIGAGGLGDLILLGIDRNNASLI
                    ************************************************************

    COL             LLGAIPAALLAIIFDLILRFMAKLSYKKLLMTLGVIVMIIILAIAIPMFAQKGDKITLAG
    N315            LLGAIPAALLAIIFDLILRFMAKLSYKKLLMTLGVIVMIIILAIAIPMFAQKGDKITLAG
    NCTC8325        LLGAIPAALLAIIFDLILRFMAKLSYKKLLMTLGVIVMIIILAIAIPMFAQKGDKITLAG
    Newman          LLGAIPAALLAIIFDLILRFMAKLSYKKLLMTLGVIVMIIILAIAIPMFAQKGDKITLAG
    USA300_FPR3757  LLGAIPAALLAIIFDLILRFMAKLSYKKLLMTLGVIVMIIILAIAIPMFAQKGDKITLAG
                    ************************************************************

    COL             KLGSEPSIITNMYKILIEEETKNTVEVKDGMGKTAFLFNALKSDDIDGYLEFTGTVLGEL
    N315            KLGSEPSIITNMYKILIEEETKNTVEVKDGMGKTAFLFNALKSDDIDGYLEFTGTVLGEL
    NCTC8325        KLGSEPSIITNMYKILIEEETKNTVEVKDGMGKTAFLFNALKSDDIDGYLEFTGTVLGEL
    Newman          KLGSEPSIITNMYKILIEEETKNTVEVKDGMGKTAFLFNALKSDDIDGYLEFTGTVLGEL
    USA300_FPR3757  KLGSEPSIITNMYKILIEEETKNTVEVKDGMGKTAFLFNALKSDDIDGYLEFTGTVLGEL
                    ************************************************************

    COL             TKEPLKSKEEKKVYEQAKQSLEKKYQMTMLKPMKYNNTYALAVKRDFAKQHNIRTIGDLN
    N315            TKEPLKSKEEKKVYEQAKQSLEKKYQMTMLKPMKYNNTYALAVKRDFAKQHNIRTIGDLN
    NCTC8325        TKEPLKSKEEKKVYEQAKQSLEKKYQMTMLKPMKYNNTYALAVKRDFAKQHNIRTIGDLN
    Newman          TKEPLKSKEEKKVYEQAKQSLEKKYQMTMLKPMKYNNTYALAVKRDFAKQHNIRTIGDLN
    USA300_FPR3757  TKEPLKSKEEKKVYEQAKQSLEKKYQMTMLKPMKYNNTYALAVKRDFAKQHNIRTIGDLN
                    ************************************************************

    COL             KVKDQLKPGFTLEFNDRPDGYKAVQKAYNLNLDNIRTMEPKLRYQAINKGNINLIDAYST
    N315            KVKDQLKPGFTLEFNDRPDGYKAVQKAYNLNLDNIRTMEPKLRYQAINKGNINLIDAYST
    NCTC8325        KVKDQLKPGFTLEFNDRPDGYKAVQKAYNLNLDNIRTMEPKLRYQAINKGNINLIDAYST
    Newman          KVKDQLKPGFTLEFNDRPDGYKAVQKAYNLNLDNIRTMEPKLRYQAINKGNINLIDAYST
    USA300_FPR3757  KVKDQLKPGFTLEFNDRPDGYKAVQKAYNLNLDNIRTMEPKLRYQAINKGNINLIDAYST
                    ************************************************************

    COL             DAELKQYDMVVLKDDKHVFPPYQGAPLFKESFLKKHPEIKKPLNKLENKISDEDMQMMNY
    N315            DAELKQYDMVVLKDDKHVFPPYQGAPLFKESFLKKHPEIKKPLNKLENKISDEDMQMMNY
    NCTC8325        DAELKQYDMVVLKDDKHVFPPYQGAPLFKESFLKKHPEIKKPLNKLENKISDEDMQMMNY
    Newman          DAELKQYDMVVLKDDKHVFPPYQGAPLFKESFLKKHPEIKKPLNKLENKISDEDMQMMNY
    USA300_FPR3757  DAELKQYDMVVLKDDKHVFPPYQGAPLFKESFLKKHPEIKKPLNKLENKISDEDMQMMNY
                    ************************************************************

    COL             KVTVKNEDPYTVAKDYLKAKGLIK
    N315            KVTVKNEDPYTVAKDYLKAKGLIK
    NCTC8325        KVTVKNEDPYTVAKDYLKAKGLIK
    Newman          KVTVKNEDPYTVAKDYLKAKGLIK
    USA300_FPR3757  KVTVKNEDPYTVAKDYLKAKGLIK
                    ************************