From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002611000
  • symbol?: hisC
  • description?: histidinol-phosphate aminotransferase

      descriptions from strain specific annotations:

    • histidinol-phosphate aminotransferase
    • Biosynthetic Aromatic amino acid aminotransferase beta
    • putative aminotransferase
    • histidinol-phosphate transaminase
  • strand?: +
  • coordinates?: 3122926..3124158
  • synteny block?: BlockID0018470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0784 (hisC)
    N315:
    NCTC8325:
    Newman:
    NWMN_0692 (hisC)
    USA300_FPR3757:
    04-02981:
    SA2981_0701
    08BA02176:
    C248_0809
    11819-97:
    MS7_0775 (hisC)
    71193:
    ST398NM01_0801
    ECT-R 2:
    ECTR2_674 (hisC)
    ED133:
    SAOV_0758 (hisC)
    ED98:
    SAAV_0685 (hisC)
    HO 5096 0412:
    SAEMRSA15_06500
    JH1:
    SaurJH1_0764
    JH9:
    SaurJH9_0747
    JKD6008:
    SAA6008_00739
    JKD6159:
    SAA6159_00678
    LGA251:
    SARLGA251_06570
    M013:
    M013TW_0710
    MRSA252:
    SAR0777
    MSHR1132:
    SAMSHR1132_06690
    MSSA476:
    SAS0689
    Mu3:
    SAHV_0721
    Mu50:
    SAV0724
    MW2:
    MW0686
    RF122:
    SAB0673
    ST398:
    SAPIG0801 (hisC)
    T0131:
    SAT0131_00793
    TCH60:
    HMPREF0772_12463 (hisC2)
    TW20:
    SATW20_07990
    USA300_TCH1516:
    USA300HOU_0747 (hisC1)
    VC40:
    SAVC_03250

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKEQLNQLSAYQPGLSPRALKEKYGIEGDLYKLASNENLYGPSPKVKEAISAHLDELYYY
    N315            MKEQLNQLSAYQPGLSPRALKEKYGIEGDLYKLASNENLYGPSPKVKEAISAHLDELYYY
    NCTC8325        MKEQLNQLSAYQPGLSPRALKEKYGIEGDLYKLASNENLYGPSPKVKEAISAHLDELYYY
    Newman          MKEQLNQLSAYQPGLSPRALKEKYGIEGDLYKLASNENLYGPSPKVKEAISAHLDELYYY
    USA300_FPR3757  MKEQLNQLSAYQPGLSPRALKEKYGIEGDLYKLASNENLYGPSPKVKEAISAHLDELYYY
                    ************************************************************

    COL             PETGSPTLKAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHN
    N315            PETGSPTLKAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHN
    NCTC8325        PETGSPTLKAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHN
    Newman          PETGSPTLKAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHN
    USA300_FPR3757  PETGSPTLKAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPGDTIVTSEATFGQYYHN
                    ************************************************************

    COL             AIVESANVIQVPLKDGGFDLEGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVP
    N315            AIVESANVIQVPLKDGGFDLEGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVP
    NCTC8325        AIVESANVIQVPLKDGGFDLEGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVP
    Newman          AIVESANVIQVPLKDGGFDLEGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVP
    USA300_FPR3757  AIVESANVIQVPLKDGGFDLEGILKEVNEDTSLVWLCNPNNPTGTYFNHESLDSFLSQVP
                    ************************************************************

    COL             PHVPVIIDEAYFEFVTAEDYPDTLALQQKYDNAFLLRTFSKAYGLAGLRVGYVVASEHAI
    N315            PHVPVIIDEAYFEFVTAEDYPDTLALQQKYDNAFLLRTFSKAYGLAGLRVGYVVASEHAI
    NCTC8325        PHVPVIIDEAYFEFVTAEDYPDTLALQQKYDNAFLLRTFSKAYGLAGLRVGYVVASEHAI
    Newman          PHVPVIIDEAYFEFVTAEDYPDTLALQQKYDNAFLLRTFSKAYGLAGLRVGYVVASEHAI
    USA300_FPR3757  PHVPVIIDEAYFEFVTAEDYPDTLALQQKYDNAFLLRTFSKAYGLAGLRVGYVVASEHAI
                    ************************************************************

    COL             EKWNIIRPPFNVTRISEYAAVAALEDQQYLKEVTHKNSVERERFYQLPQSEYFLPSQTNF
    N315            EKWNIIRPPFNVTRISEYAAVAALEDQQYLKEVTHKNSVERERFYQLPQSEYFLPSQTNF
    NCTC8325        EKWNIIRPPFNVTRISEYAAVAALEDQQYLKEVTHKNSVERERFYQLPQSEYFLPSQTNF
    Newman          EKWNIIRPPFNVTRISEYAAVAALEDQQYLKEVTHKNSVERERFYQLPQSEYFLPSQTNF
    USA300_FPR3757  EKWNIIRPPFNVTRISEYAAVAALEDQQYLKEVTHKNSVERERFYQLPQSEYFLPSQTNF
                    ************************************************************

    COL             IFVKTKRVNELYEALLNVGCITRPFPTGVRITIGFKEQNDKMLEVLSNFKYE
    N315            IFVKTKRVNELYEALLNVGCITRPFPTGVRITIGFKEQNDKMLEVLSNFKYE
    NCTC8325        IFVKTKRVNELYEALLNVGCITRPFPTGVRITIGFKEQNDKMLEVLSNFKYE
    Newman          IFVKTKRVNELYEALLNVGCITRPFPTGVRITIGFKEQNDKMLEVLSNFKYE
    USA300_FPR3757  IFVKTKRVNELYEALLNVGCITRPFPTGVRITIGFKEQNDKMLEVLSNFKYE
                    ****************************************************