From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002623000
  • symbol?: dtpT
  • description?: di-tripeptide ABC transporter

      descriptions from strain specific annotations:

    • di-tripeptide ABC transporter
    • amino acid/peptide transporter
    • proton-dependent oligopeptide transporter family protein
    • Di/tripeptide permease YjdL
    • amino acid/peptide transporter (Peptide:H+ symporter) family protein
    • di-/tripeptide ABC transporter
    • putative proton-dependent oligopeptide transportprotein
    • POT family proton (H+)-dependent oligopeptide transporter
    • proton-dependent oligopeptide transport protein
    • amino acid/peptide transporter (peptide:H+ symporter)
    • H+ symporter family protein
    • di-/tripeptide transporter
  • strand?: -
  • coordinates?: 3128836..3130341
  • synteny block?: BlockID0018580
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0705 (yjdL)
    08BA02176:
    C248_0814
    11819-97:
    MS7_0778
    71193:
    ST398NM01_0804
    ECT-R 2:
    ECTR2_677
    ED133:
    SAOV_0762c
    ED98:
    SAAV_0688
    HO 5096 0412:
    SAEMRSA15_06530
    JH1:
    SaurJH1_0767
    JH9:
    SaurJH9_0750
    JKD6008:
    SAA6008_00742
    JKD6159:
    SAA6159_00682
    LGA251:
    SARLGA251_06600
    M013:
    M013TW_0713
    MRSA252:
    SAR0781
    MSHR1132:
    SAMSHR1132_06720
    MSSA476:
    SAS0692
    Mu3:
    SAHV_0724
    Mu50:
    SAV0727
    MW2:
    MW0689
    RF122:
    SAB0676c
    ST398:
    SAPIG0804
    T0131:
    SAT0131_00797
    TCH60:
    HMPREF0772_12459
    TW20:
    SATW20_08020
    USA300_TCH1516:
    USA300HOU_0751
    VC40:
    SAVC_03270

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTQQNSHGNQIQDIPQTGFFGHPRGLGVLFFVEFWERFSYYGMRALLIFYMYFAVTDNGL
    N315            MTQQNSHGNQIQDIPQTGFFGHPRGLGVLFFVEFWERFSYYGMRALLIFYMYFAVTDNGL
    NCTC8325        MTQQNSHGNQIQDIPQTGFFGHPRGLGVLFFVEFWERFSYYGMRALLIFYMYFAVTDNGL
    Newman          MTQQNSHGNQIQDIPQTGFFGHPRGLGVLFFVEFWERFSYYGMRALLIFYMYFAVTDNGL
    USA300_FPR3757  MTQQNSHGNQIQDIPQTGFFGHPRGLGVLFFVEFWERFSYYGMRALLIFYMYFAVTDNGL
                    ************************************************************

    COL             GIDKTTAMSIMSVYGSLIYMTSIPGGWIADRITGTRGATLLGAVFIIIGHICLSLPFALI
    N315            GIDKTTAMSIMSVYGSLIYMTSIPGGWIADRITGTRGATLLGAVFIIIGHICLSLPFALI
    NCTC8325        GIDKTTAMSIMSVYGSLIYMTSIPGGWIADRITGTRGATLLGAVFIIIGHICLSLPFALI
    Newman          GIDKTTAMSIMSVYGSLIYMTSIPGGWIADRITGTRGATLLGAVFIIIGHICLSLPFALI
    USA300_FPR3757  GIDKTTAMSIMSVYGSLIYMTSIPGGWIADRITGTRGATLLGAVFIIIGHICLSLPFALI
                    ************************************************************

    COL             GLFTSMFFIIIGSGLMKPNISNIVGRLYPENDRRMDAGFVIFYMSVNMGALLSPIILQHF
    N315            GLFTSMFFIIIGSGLMKPNISNIVGRLYPENDRRMDAGFVIFYMSVNMGALLSPIILQHF
    NCTC8325        GLFTSMFFIIIGSGLMKPNISNIVGRLYPENDRRMDAGFVIFYMSVNMGALLSPIILQHF
    Newman          GLFTSMFFIIIGSGLMKPNISNIVGRLYPENDRRMDAGFVIFYMSVNMGALLSPIILQHF
    USA300_FPR3757  GLFTSMFFIIIGSGLMKPNISNIVGRLYPENDRRMDAGFVIFYMSVNMGALLSPIILQHF
                    ************************************************************

    COL             VNVKNFHGGFLIAAVGMALGLVWYVLFNRKNLGSVGMKPTNPLTPAEKKKYGLIIGSVVL
    N315            VNVKNFHGGFLIAAVGMALGLVWYVLFNRKNLGSVGMKPTNPLTPAEKKKYGLIIGSVVL
    NCTC8325        VNVKNFHGGFLIAAVGMALGLVWYVLFNRKNLGSVGMKPTNPLTPAEKKKYGLIIGSVVL
    Newman          VNVKNFHGGFLIAAVGMALGLVWYVLFNRKNLGSVGMKPTNPLTPAEKKKYGLIIGSVVL
    USA300_FPR3757  VNVKNFHGGFLIAAVGMALGLVWYVLFNRKNLGSVGMKPTNPLTPAEKKKYGLIIGSVVL
                    ************************************************************

    COL             AIVLIIVIGALTNSLSFNLVSNTVLVLGIALPIIYFTLIIRSKDVTDTERSRVKAFIPLF
    N315            AIVLIIVIGALTNSLSFNLVSNTVLVLGIALPIIYFTLIIRSKDVTDTERSRVKAFIPLF
    NCTC8325        AIVLIIVIGALTNSLSFNLVSNTVLVLGIALPIIYFTLIIRSKDVTDTERSRVKAFIPLF
    Newman          AIVLIIVIGALTNSLSFNLVSNTVLVLGIALPIIYFTLIIRSKDVTDTERSRVKAFIPLF
    USA300_FPR3757  AIVLIIVIGALTNSLSFNLVSNTVLVLGIALPIIYFTLIIRSKDVTDTERSRVKAFIPLF
                    ************************************************************

    COL             ILGMVFWAIQEQGSNVLNIYGIEHSDMKLNLFGWKTNFGEAIFQSINPLFILLLAPIISL
    N315            ILGMVFWAIQEQGSNVLNIYGIEHSDMKLNLFGWKTNFGEAIFQSINPLFILLLAPIISL
    NCTC8325        ILGMVFWAIQEQGSNVLNIYGIEHSDMKLNLFGWKTNFGEAIFQSINPLFILLLAPIISL
    Newman          ILGMVFWAIQEQGSNVLNIYGIEHSDMKLNLFGWKTNFGEAIFQSINPLFILLLAPIISL
    USA300_FPR3757  ILGMVFWAIQEQGSNVLNIYGIEHSDMKLNLFGWKTNFGEAIFQSINPLFILLLAPIISL
                    ************************************************************

    COL             LWQKLGTKQPSLPVKFAIGTFLAGASYILIGIVGYASGSSNFSVNWVILSYIICVIGELC
    N315            LWQKLGTKQPSLPVKFAIGTFLAGASYILIGIVGYASGSSNFSVNWVILSYIICVIGELC
    NCTC8325        LWQKLGTKQPSLPVKFAIGTFLAGASYILIGIVGYASGSSNFSVNWVILSYIICVIGELC
    Newman          LWQKLGTKQPSLPVKFAIGTFLAGASYILIGIVGYASGSSNFSVNWVILSYIICVIGELC
    USA300_FPR3757  LWQKLGTKQPSLPVKFAIGTFLAGASYILIGIVGYASGSSNFSVNWVILSYIICVIGELC
                    ************************************************************

    COL             LSPTGNSAAVKLAPKAFNAQMMSIWYLTNASAQAINGTLVKLIEPLGQTNYFIFLGVVAI
    N315            LSPTGNSAAVKLAPKAFNAQMMSIWYLTNASAQAINGTLVKLIEPLGQTNYFIFLGVVAI
    NCTC8325        LSPTGNSAAVKLAPKAFNAQMMSIWYLTNASAQAINGTLVKLIEPLGQTNYFIFLGVVAI
    Newman          LSPTGNSAAVKLAPKAFNAQMMSIWYLTNASAQAINGTLVKLIEPLGQTNYFIFLGVVAI
    USA300_FPR3757  LSPTGNSAAVKLAPKAFNAQMMSIWYLTNASAQAINGTLVKLIEPLGQTNYFIFLGVVAI
                    ************************************************************

    COL             IVTTIVLAFSPLIIKAMKGIR
    N315            IVTTIVLAFSPLIIKAMKGIR
    NCTC8325        IVTTIVLAFSPLIIKAMKGIR
    Newman          IVTTIVLAFSPLIIKAMKGIR
    USA300_FPR3757  IVTTIVLAISPLIIKAMKGIR
                    ********:************